KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_203189Help
Entry
BRAFLDRAFT_203189 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00010  Glycolysis / Gluconeogenesis
bfo00562  Inositol phosphate metabolism
bfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRAFLDRAFT_203189
   00562 Inositol phosphate metabolism
    BRAFLDRAFT_203189
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     BRAFLDRAFT_203189
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     BRAFLDRAFT_203189
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 EHN Ntox3
Motif
Other DBs
NCBI-GeneID: 7214208
NCBI-ProteinID: XP_002596211
JGI: 203189
UniProt: C3Z5W0
AA seq 449 aa AA seqDB search
DPRSSVKRDTFATKTKYDASFTWLERTERDKILTETCPHLRQCKPVHVSMLIRHGTRYPK
KNDISKIDYVVSSIRHYGSKEKDIVNVMRRWQNSFEWQDAMMLAETGKWEMEELASRIVQ
RFPEVFHGAKPESLRFVSSTKNRTVDSTSAFVRGLWNGLKEMKAADSIKDPRKLQTNAGP
HTDTLLLFLENCKRWTEEVERNTEALQEVSKFLDGPEVRSVLKNITSQLGPSVLLDFSVA
HLKVMWTICAMETAVYGGRSIWCDLFKTEDLQVLEYLSDLTSYWKHGYGHRLNYRLACAL
LQEMLKPMEGFVSGNESRSAPSSHDSHHLGQFLFGHTESLVPFYSLLGLFKDREPLRADN
FAEHKNRVFRTSFISPFGANIALVLYKCDGISPWSKFRVMMMVNERVEQFPGWHQASCPY
EVVRMLYKNVLEHCEDVCEMSSEKSHPEL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gacccacgcagttctgtgaaacgtgacacttttgccaccaagacgaaatacgacgcttcc
ttcacctggctggagaggacagaaagagacaagattctgacggaaacatgcccgcacctc
cgccaatgcaaacctgttcatgtcagcatgctgataaggcatgggacgcgatatcccaaa
aagaacgacatcagcaaaattgactacgttgtctcatcgattcgccactacgggtcgaag
gaaaaggacatcgtgaacgtgatgagacggtggcagaactcatttgagtggcaagatgca
atgatgctcgcggaaacaggcaaatgggaaatggaggaactcgcgagtcgcattgtccaa
cgttttcctgaggtattccatggtgcaaaacccgagagcttaagatttgtaagcagtaca
aagaacaggacagtagacagtacctctgcatttgtaagaggactttggaatgggttgaag
gaaatgaaagcagccgacagtataaaggaccctcgtaaattgcagaccaatgcaggtccg
catacagacacactcttactctttcttgagaactgcaagaggtggactgaagaagttgag
cgaaacacagaggccttacaagaagtgtcaaagttcttggatggccccgaggttcggagt
gtgttgaagaacattacctcacagctaggaccttcagtgctgctggatttctcagtagct
cacttgaaggtgatgtggaccatctgtgcaatggagactgcagtgtacggaggccggtct
atctggtgtgacctgtttaagactgaagacctacaggtgctggagtacctttcagacctg
acatcgtactggaagcatggttatggacacaggctgaactacagactggcctgtgccctg
ctgcaggagatgctcaaacctatggagggtttcgtctcaggaaatgaaagcaggtcagca
ccatcctctcatgacagccaccacttaggacagttcctgtttggccacacagaatcactg
gttcccttctacagtctcctggggctattcaaggacagggagcctctaagggcggacaac
tttgccgaacacaagaatcgcgtgtttcgtacgtccttcatatctccgtttggagccaac
atcgccctcgtgctgtacaagtgtgacggcatctcaccatggtcaaagttcagagtgatg
atgatggtgaatgagcgggtggagcagttccctggatggcatcaggcttcgtgtccctat
gaggttgtcaggatgttgtacaagaatgttcttgaacattgtgaggatgtgtgtgagatg
agcagtgaaaagagtcatccagagttgtaa

DBGET integrated database retrieval system