KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_217213Help
Entry
BRAFLDRAFT_217213 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bfo03019]
    BRAFLDRAFT_217213
Enzymes [BR:bfo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     BRAFLDRAFT_217213
Messenger RNA biogenesis [BR:bfo03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     BRAFLDRAFT_217213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70
Motif
Other DBs
NCBI-GeneID: 7211193
NCBI-ProteinID: XP_002604890
JGI: 217213
UniProt: C3YFD7
AA seq 568 aa AA seqDB search
MSDTWSSIQAHRKSQESLRERLQRRRRQGLGLDIEGLVAGPSSDSKPSSRSSSPTPQPPA
PTPKAEDVTNIDPDVEKKLLACLNDQDMTIPTDSSILQGRVAKVQAEKDVSQACVESLLQ
KFAAQELIVIKSSVTDAGTSCIVVTELDHSKLLQSGAEVSEKSGVVHGELAKQKHKTIVK
MSAFTVLVTSLAYYSPAPEERVTKTVSKKKEDLGDDSIESLLSMPTIKEQETKEMGEEIF
DLLSKPTAKEQSLVEKFKSQGGAQVQEFCPHGTKEECRKERRANHACNKLHFKKIIKDHT
DESLGDCSFLNTCFHMDTCKYVHYEIEFPEGDAKLDQEQKVALAKAVKPKNSAHILYPSQ
WVQCDIRRIDMEVLGKFSVVMADPPWDIHMDLPYGTMTDDEMRTLNVSAIQDEGYIFLWV
TGRAMELGRECLKLWGYERVDELIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGAKGTPF
WTNRGLDADVIVAEVRETSHKPDEVYGIIERLAPGRRKIELFGRMHNVQPNWVTLGNQLD
GVHLVDPEMVDRFRQRYPDGDRSYLKPS
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatacatggagcagtatccaagctcacaggaagagccaggagagtctcagggag
cggctacagcgccgcaggcgacagggactcggtctggatatcgagggcctggtggcaggg
cccagtagtgactccaagcccagctcccggagcagcagccccaccccacagccgccagca
ccaacccccaaggcagaggacgtcaccaacatcgaccctgatgtggagaaaaagctgctg
gcctgtctgaacgaccaggacatgaccatacccacagattccagcattctacagggcagg
gtggcaaaggtacaggctgagaaggatgtttcacaagcatgtgtggagagcctactacag
aaatttgcagcacaggagttgatagtgataaaaagcagtgtaacagatgctgggacatct
tgcatagttgtgacagaactggaccattccaagctgctacagtcgggggcggaggtctca
gaaaaatcaggtgttgttcatggtgaattggccaagcaaaaacataaaaccatcgtgaaa
atgtctgcatttacagtactagtaacatcgttagcatactattcccctgcaccagaggag
cgtgtgaccaaaacagtgagtaagaagaaggaagacttgggcgatgacagtatcgagagc
ctcctgtctatgccaaccataaaggaacaagagacaaaagagatgggagaagagatattc
gatcttctaagtaagcccactgcaaaggagcagtcattggtcgaaaagttcaagtcacaa
ggaggtgcgcaggtacaggagttctgtccacacggcacaaaggaggagtgcagaaaggaa
agaagggcaaaccatgcctgcaacaagctccatttcaagaaaatcatcaaggaccacact
gatgaatctcttggggactgttccttcctcaatacatgtttccacatggacacatgcaag
tatgtccactatgagatagagttcccagagggagatgctaaactggaccaggagcaaaaa
gttgctctagcaaaggctgtcaagcccaagaactcagcacatatcctgtatccatcacag
tgggtccagtgcgatatccgccgcattgacatggaggttttggggaagttttcggtggta
atggctgaccccccctgggacatccacatggacttgccctacggcaccatgacagatgat
gagatgaggaccctgaatgtttcagccattcaggatgagggttacatcttcctttgggtc
actggcagggccatggaactgggacgggagtgtctcaaactttgggggtatgagagggtg
gatgagctgatttgggttaagactaaccagctgcagcggatcatccggacaggccgcacc
gggcactggctcaaccacggcaaggaacactgcctggttggggcaaaaggcaccccattc
tggaccaacagaggactggatgctgatgtcattgttgctgaggtacgtgagaccagccac
aagcctgatgaagtgtacggcatcattgagcgcctcgcccccggtcgcaggaagattgag
ctgtttggcaggatgcacaatgttcagccaaactgggtaaccctcggtaaccagctggac
ggagtacacttggtggaccctgagatggttgaccgattccgacagaggtacccggacgga
gacaggagctacctaaaaccctcctaa

DBGET integrated database retrieval system