KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_222784Help
Entry
BRAFLDRAFT_222784 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00564  Glycerophospholipid metabolism
bfo01100  Metabolic pathways
Module
bfo_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
bfo_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BRAFLDRAFT_222784
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     BRAFLDRAFT_222784
    2.7.1.82  ethanolamine kinase
     BRAFLDRAFT_222784
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase
Motif
Other DBs
NCBI-GeneID: 7227337
NCBI-ProteinID: XP_002597442
JGI: 222784
UniProt: C3Z1T7
AA seq 362 aa AA seqDB search
MAENNNGLDPAFHHKAWTICHDYLGLPWKEIPEKEFIVETLPGGLSNYLYICTVPDKYVV
KGVPRKILLRIYGEILSDVPTVIQDSVIYSILSEKKMAPQLRGIFDGGRLEEFKESRTLT
TADLSNPTLSAIIGRKMARLHRLEMPLCKEPKWLTEHLKSYLSNILNNISFKDETKSQQL
KQLLSYNLEAELQFILRLIEDTHSPVVFCHNDLQEGNIMVDDKDGAAPTDDRVTVIDYEY
SAYNYRGCEFANHFCEWAMDYTHPKWPHFTLDRLAWPSRKQQLHLIDAYLSESGDVSADR
DAILQEVERFALVSHYWWSLWSIAQAYMSHISFGFLEYALARFDWYFEMKKNLTCNRKHA
GL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaacaacaacggtctggacccggcgtttcaccacaaggcgtggacaatctgc
cacgactacctcgggctgccctggaaggagattccagagaaggagttcatcgttgagacg
ctccccgggggactgagtaactacctctatatctgcactgttcctgacaaatatgtagtc
aaaggtgttccacgtaagatcttgttgcggatctacggagagattctgagcgacgtgccg
accgtgatccaagattctgtcatctacagcatcctgtccgagaagaagatggctccccag
ctgagggggatcttcgatgggggcaggctagaagagttcaaggaatcccgaaccctgacc
acagcagacttgtccaaccccaccctgtctgcgatcatcgggcggaagatggctcggctc
cacagactggagatgcctctgtgtaaggaacccaagtggctcactgagcacttaaaaagc
tacctcagcaacatcctgaacaacatctccttcaaggacgagaccaagtctcagcagctg
aagcagctcctgtcttacaacctggaggcagagctgcagttcatcctcaggctcatagag
gacacccactcccctgtcgtcttctgccacaacgacctgcaagaagggaacatcatggtg
gacgacaaggacggggcggcccccaccgacgacagggtcaccgtcatcgactacgagtac
agcgcctacaactaccgcggctgcgagttcgccaaccacttctgcgagtgggccatggac
tacacccaccccaagtggcctcacttcaccctcgaccgcctggcctggccctcgcggaag
cagcagctccatctcatcgacgcctacctctcggagagcggcgatgtttccgcggaccgt
gatgcgatactgcaggaggttgagaggtttgcgctggtgtcccactactggtggagcctg
tggtctatagcacaggcctacatgagccatataagcttcgggttcctggagtacgcgctg
gctcggttcgactggtacttcgagatgaagaagaaccttacctgtaacaggaaacatgcc
gggttatga

DBGET integrated database retrieval system