KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_228782Help
Entry
BRAFLDRAFT_228782 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K02449  cyclin-dependent kinase 10 [EC:2.7.11.22]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bfo01001]
    BRAFLDRAFT_228782
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     BRAFLDRAFT_228782
Protein kinases [BR:bfo01001]
 Serine/threonine kinases: CMGC group
  CDK family
   BRAFLDRAFT_228782
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase RIO1 Pkinase_fungal Kdo APH
Motif
Other DBs
NCBI-GeneID: 7247424
NCBI-ProteinID: XP_002604664
JGI: 228782
UniProt: C3YGF4
AA seq 334 aa AA seqDB search
HQLGKCRSVQEFEKLNRLGEGTYGIVYRARDTRSGEIVALKKMRMDREKDGLPISGLREI
TLLLNVTHRNIVDLKEVVVGTKSLESIFLVMEYCEQDLASLLDNMDTPFSEAQVKCIMLQ
VFNGLEYLHDNFIIHRDLKVSNLLMTDKGCIKIADFGLARTFGLPPKPMTPRVVTLWYRS
PELLLGAKTQTTAVDMWAAGCIFGELLAHKPLLPGRSEIHQLELIVELLGTPSEAIWPGF
SQLPALEQISLKKQPYNNLKHRFPWLSEAGLRLLNFLFMYDPKKRGSAEECMKSSYFKEK
PLPTEPELMPTFPHHRNRRRSVQRPEARSGMVAL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
catcagcttggtaagtgccggagtgttcaagagtttgagaaactcaacagactcggcgag
ggcacctatggcatagtttatcgagccagagacacacggtccggagagattgttgcactc
aagaagatgaggatggatcgggagaaggatggactgcccatcagtgggctacgtgagatc
acactgctgctgaatgtgacccacaggaacattgtggacctgaaggaagtggtggtgggg
actaagagtctggaaagcatcttccttgtcatggagtactgtgaacaggacctggccagc
ctgctggataacatggacaccccattctcagaggcacaggtgaagtgcatcatgctgcag
gtgttcaatgggctggaatatctccatgacaacttcatcatccacagggacctgaaggtt
tccaacctcctcatgacagacaagggctgcatcaagattgctgactttggtcttgccaga
acatttggactgccccccaagcctatgacccccagagttgtgaccctctggtataggtca
cctgaactgctgctgggggccaagacacagactactgctgtagatatgtgggctgctggt
tgtatatttggggagctcctggcccataagcctttgcttccaggcagatcagaaatccac
caactggaacttattgtggaactgctaggtaccccaagtgaagccatctggcctggattc
tcccagctgccagcattagaacagatcagcctgaagaagcagccctacaacaacctaaaa
catcgcttcccttggctgtctgaagctggactcagacttctgaacttcctcttcatgtat
gatcctaagaaaaggggcagtgcagaagagtgtatgaaaagttcctacttcaaagagaag
cccctccccacagagcctgagctgatgcccaccttccctcaccacaggaacaggagaaga
agtgtgcagagaccagaggccaggtcaggcatggttgcactatag

DBGET integrated database retrieval system