KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_230606Help
Entry
BRAFLDRAFT_230606 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00511  Other glycan degradation
bfo00520  Amino sugar and nucleotide sugar metabolism
bfo00531  Glycosaminoglycan degradation
bfo00603  Glycosphingolipid biosynthesis - globo and isoglobo series
bfo00604  Glycosphingolipid biosynthesis - ganglio series
bfo01100  Metabolic pathways
bfo04142  Lysosome
Module
bfo_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BRAFLDRAFT_230606
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    BRAFLDRAFT_230606
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    BRAFLDRAFT_230606
   00604 Glycosphingolipid biosynthesis - ganglio series
    BRAFLDRAFT_230606
   00511 Other glycan degradation
    BRAFLDRAFT_230606
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    BRAFLDRAFT_230606
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BRAFLDRAFT_230606
Chaperones and folding catalysts [BR:bfo03110]
 Intramolecular chaperones
  Others
   BRAFLDRAFT_230606
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 7249158
NCBI-ProteinID: XP_002601536
JGI: 230606
UniProt: C3YQ45
AA seq 506 aa AA seqDB search
MVQQTGKVLPKPQMMTVSAEAYTLAMSRFKFTYGSSSEMCDIVDQAFRRYYDLIFDVDGP
KKAPKVPESMAELTVLQVMVKEPCKGAYPSLDSSENYTLTVTAPMGMLVADSAWGVLRGL
ETFSQLIYRTDDGTMIINKTTVDDFPRFAHRGILLDTSRHFIPLKYIKQNLDAMAYNKFN
VFHWHIVDDQSFPYQSVVFPDLSAKGAFNPYTHLYTQEDVKDVIEYSRLRGIRVVPEFDT
PGHTASWGAGLPGFLTPCYDGSTPNGKYYAANPMLNTTYDYMTKLLQEVKDVFPDKHVHL
GGDEVNFNCWKSNPDITKFMEKMGFGTDYSKLEQYYIKNILDISTSIGRDYIVWQEVLDN
GVQVAKDTVVEVWKSNPPVPTEMATVTAKGLRAILSSCWYLNYISYGDDWGKYYSCEPQD
FTGTQAQKDLVIGGEACMWGEYVDGTNLIARLWPRASAVAERLWSNKDVKNMADATVRMD
EQRCRMVRRGLNAEPLHPGFCQFEYD
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggtacaacagacgggcaaagtcttgcctaagccgcaaatgatgacggtgtctgctgaa
gcctacactctggcgatgtccaggtttaaatttacatacggctcttcctccgagatgtgc
gacatcgtggaccaggcgtttaggcggtactatgatcttatattcgacgtcgatggaccg
aagaaagctccaaaggtacctgaaagcatggccgagctgactgtactacaggtcatggtg
aaagagccatgcaagggagcctaccccagcttggactcctcagaaaactacactctgaca
gttactgctccgatgggaatgctggttgctgattcagcatggggagtgttgagaggtttg
gagacattttctcagctgatatacagaacagatgatggcacgatgatcatcaacaagact
acagtagatgactttcccaggtttgcccacagaggaatcctattggacacttcccgccat
tttattcccctcaagtacatcaagcagaatttggatgcaatggcttacaacaagttcaat
gtgttccattggcacattgtggatgaccagtccttcccatatcagagtgttgtcttccct
gatctcagtgctaagggagcctttaatccttacacccacctgtacacgcaagaggatgtt
aaggatgttatagagtactcacggctgaggggcatcagggttgtgccagagtttgacacc
cctggccatacagcctcctggggtgcaggtctcccagggttcctcacaccatgttacgat
gggtccacacccaatggaaagtactacgctgctaaccccatgctgaacaccacgtatgac
tacatgactaaactgctgcaggaagtgaaggatgtgtttcctgataagcatgtccacctg
ggtggggatgaggtgaacttcaactgctggaagagtaatccagacatcaccaaatttatg
gagaaaatgggctttggaacagactattccaaactggagcaatactacatcaaaaatatc
ctggatatctccacatccatcgggagagactatattgtgtggcaggaggtgctggataat
ggtgtgcaggtggccaaggacacagtagtggaagtgtggaagagcaatcctccagtgccc
actgaaatggctacagtaacagccaagggcttgcgggccatcctttcctcatgctggtac
ctcaattacatcagctatggagatgactggggcaaatattacagctgtgaaccacaggac
ttcactggtacacaagcccagaaagacttggtgattggtggagaggcctgcatgtgggga
gagtatgtggatggcacaaacctgattgccaggctctggcctagggccagtgctgtcgct
gagcggctgtggagcaacaaggatgtgaaaaacatggcagatgcaaccgtaaggatggac
gagcagagatgtcggatggtcaggagaggactgaatgctgaacccctccatccaggattc
tgccagtttgaatatgactga

DBGET integrated database retrieval system