KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_233542Help
Entry
BRAFLDRAFT_233542 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00260  Glycine, serine and threonine metabolism
bfo00330  Arginine and proline metabolism
bfo00472  D-Arginine and D-ornithine metabolism
bfo01100  Metabolic pathways
bfo04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BRAFLDRAFT_233542
   00330 Arginine and proline metabolism
    BRAFLDRAFT_233542
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    BRAFLDRAFT_233542
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    BRAFLDRAFT_233542
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    BRAFLDRAFT_233542
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     BRAFLDRAFT_233542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO Thi4 NAD_binding_8 UDPG_MGDP_dh_N Globin FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 7251133
NCBI-ProteinID: XP_002611046
JGI: 233542
UniProt: C3XY02
AA seq 326 aa AA seqDB search
MVRRVCVVGAGVVGLSSAVCIQEKVPGVQVTVLSEKFSPHTTSDVLLRNVIFASRRWGDE
TWDHLKTLYLSPVACDAGVILLSGYHLHKQPQQDPNWASTVFGFRHLTKEDLQQFPGFSS
GWFSTHLLCEGRKYLPWLMTKFKKAGGKVQQGKVTSLTELADHYNVVVNCCGIGAGELVG
DNTVQPVRGQVYRVNAPWVKHYLIAHEDCYYIIPCSNNVVLGGTAQKGNWNLSPHPTDSK
AIWEGCCQLVPSLRKCKVDHEWVGLRPSRPKVRLERESVGKGSSSLEVVHNYGHGGAGIT
LHWGCAQQAARLVQEALSLQQLKPKL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggtccgccgtgtgtgtgtggttggtgcgggggtggtcggcttgtcctctgctgtctgt
atccaggagaaagtccctggtgtccaagtcacagttctgtccgagaagttctctccgcac
acaacgagcgatgttttgttaagaaatgttatttttgcttccagacgttggggggatgaa
acctgggaccacctgaagactctgtacctgagtcctgtggcttgtgatgctggtgtgatt
ttactgtctggctaccacttacataaacagcctcaacaggatccaaactgggcttccaca
gtatttgggtttcgtcacctgaccaaagaagacctgcaacagtttcctggtttcagctcc
ggatggttctctacccacctgctgtgtgaaggtaggaaatatctaccctggttgatgacg
aagttcaagaaagctggaggcaaggtgcagcaggggaaggttacatcactgactgagctt
gctgaccactacaatgttgtagtgaactgctgtgggatcggtgccggagagttggtggga
gacaacacagtccagcctgtcaggggacaagtctacagggtcaatgcaccctgggtgaaa
cactatctgattgctcatgaagactgttattatatcatcccttgttccaacaatgttgtt
ctgggtggaacagcacagaaggggaactggaacctcagcccacaccccactgacagcaaa
gccatctgggaaggctgctgccaactggtgccaagtctgaggaagtgcaaagtggaccat
gagtgggtggggttacggcccagcaggccgaaggtcagactggagagagagtcggtaggg
aaaggttcctccagtcttgaggtagtgcacaactatggccatggtggggcggggatcacc
ctccactgggggtgtgctcaacaggcggccaggctagtgcaggaggcacttagcttacaa
caactcaaacccaaactgtga

DBGET integrated database retrieval system