KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_241512Help
Entry
BRAFLDRAFT_241512 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    BRAFLDRAFT_241512
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 7256168
NCBI-ProteinID: XP_002586899
JGI: 241512
UniProt: C3ZX32
AA seq 599 aa AA seqDB search
EPTWKYQDSLPPLPVPPLKNTLDKYLESVKPFVTAEEYKQTEAVVREFEEGVGQSLHQQL
LERAKVKRNWIEEWWLDLVYLRSRPSLPLTSNIAGFIPMTDHMWPSGVEPEDQVPLYLWA
SMHLWKLLRNKQSYYLQLLKSIPFCMDQFRNMLSAHRIPGVTMDKIVSHFRTESEGPSPT
HITVLCKGRVFKMDDIHHSSSVSPGDAEEEQLQMLKQQCENMSEGPHISALTAGNRTEWA
KTREKMVEMDPVNAHNLSVIEKSIVVVAFDDAMPKDGGEVGGDALVGSSRNRWFDHFNTG
VVFKSGLYASNFEHSPADGMVAVYWGYFLFAQLQRIGPIHKAQVPARPVPKPEELIFIID
DEIRDAVIHTEETFIKQASDMELICPSFTDYGKKFIRSFKLHPDSYMQTALQLAYFRLHG
KPAPTYESATLRQYYHGRTETVRSCTMEVVNWCKAMVDNTVPVEEKKELMMVALKKHLQI
MDEAKSMLGKCCDRHLFGLQVLDQGAGIPLPSIFTDAAYTKSGGGGNFVLSTSLLGYTPC
PGATSPMVHHGYGIFYNIQSDRIMYTISAWKSCKETSAEEMSASIQQSLRDMRQLLIMS
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
gagccgacatggaagtaccaggactccctcccacctttacctgtacctcctctcaagaac
acactggacaagtatctagagtctgtaaagccgtttgtgacggcggaggaatacaagcag
acagaggcggtggtgagggagtttgaagaaggggttggccaatcgctgcatcagcaatta
ctggagagggcaaaggttaaaaggaactggattgaagagtggtggctggatctagtgtac
cttcggtctcgcccctccctccccctgacttccaacattgccgggttcataccgatgacg
gaccacatgtggccgtctggagtggagcctgaggaccaggtcccgctgtatctctgggcg
tccatgcatctgtggaaactcctcaggaacaaacaatcgtactaccttcaactgcttaaa
agcatcccattctgtatggaccagtttcgtaacatgttatcagctcataggattcctggt
gtgaccatggacaagattgtcagccactttaggacagaatctgaaggcccatcacccacc
cacattaccgtgctgtgtaagggacgtgtgttcaagatggatgacatccatcactcttcg
tcagtgtcacctggtgacgctgaagaagagcaactgcaaatgctgaaacaacaatgtgag
aacatgtcagagggacctcacatctctgcgctgactgcgggaaacaggacggaatgggca
aagactagagagaagatggtggagatggacccagtcaatgctcataacctgtccgtcatc
gagaagagtatcgtggtagtagcgtttgacgatgccatgccgaaggacggtggagaggta
ggtggtgacgcgttggtgggaagtagcaggaacagatggttcgaccatttcaacacaggg
gtggtcttcaagagcggtctttacgctagtaactttgagcattccccagctgatggcatg
gtggctgtatactggggatacttcctttttgctcagttacagaggattggtccaatacac
aaggctcaggttcccgccaggcccgttccgaaaccagaggaactgattttcatcatagat
gacgagatacgtgatgcagtcatacatacagaggagacattcattaaacaggcttccgac
atggaactaatctgccccagcttcacagactatgggaagaagttcatccgcagtttcaag
ctccacccggactcctacatgcagactgcactacagctggcgtacttcaggctgcatgga
aaacctgccccgacgtacgagtcggcaaccctgcggcagtactaccacggccggactgag
actgtccggtcctgcaccatggaagtggtcaactggtgtaaggccatggtggacaacaca
gttccggttgaagagaagaaagaactaatgatggtggcgttgaagaaacatttacaaatt
atggatgaggcaaaaagcatgctgggtaagtgctgcgatcgtcacctctttggtctgcaa
gttcttgaccaaggtgcagggattccccttccttcaatcttcacagacgctgcctacacg
aaaagtgggggaggggggaacttcgtcctgtccacaagtctgcttgggtacacgccgtgc
ccaggggcaacttctcccatggtgcatcacggctatggaatcttctacaacatccagtcg
gacaggatcatgtacaccattagtgcctggaagagttgtaaggagaccagtgctgaggag
atgtcggctagtatacaacagtcacttagggacatgcgccaactcctcataatgtcataa

DBGET integrated database retrieval system