KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_262500Help
Entry
BRAFLDRAFT_262500 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bfo01001]
    BRAFLDRAFT_262500
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BRAFLDRAFT_262500
Protein kinases [BR:bfo01001]
 Serine/threonine kinases: STE group
  STE20 family
   BRAFLDRAFT_262500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNH
Motif
Other DBs
NCBI-GeneID: 7228088
NCBI-ProteinID: XP_002593185
JGI: 262500
UniProt: C3ZEP0
AA seq 322 aa AA seqDB search
MPEIRKYKKRFNSEILCAALWGVNLLIGTENGLVLLDRSGHGEVYPLISRRRFQQIDVLE
GQNILVSISGKKNKLRVYYLSWLKSKILKGDTDTERRHGWVSVGDLEGCVHYKVVKYERI
KFLVIALRNSIEVYAWAPKPYHKFMAFKSFGDLLHKPLMVDLTIEEDSRLKVIYGSGAGF
HAIDLDTSAVYDIYIPTHISSGILPHAIITLPNSKGMDLLLCYEDEGVYVNTYGKVIKDI
VLQWGEMPTSVAYIGTGQIMGWGQKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVF
FASTRSGSSSQVYFMTLNKIQW
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagatccgcaagtacaagaagaggttcaactcggagatcctctgtgctgctttg
tggggggtgaatctgctaattgggacggagaacggactggtgctgctggacaggagtgga
cacggagaagtttatcctctgatcagtcggagaaggtttcagcagatagatgttctagaa
gggcagaacatcctagtgtctatatcagggaagaagaacaaactgagggtgtactacctc
tcctggctgaagagtaagattctgaagggggatacagatactgagagaagacatggttgg
gtgtctgttggggacttagaggggtgtgtccactataaagtggtcaagtatgaaagaatc
aagttcttggtgattgcactgagaaacagcattgaggtgtatgcctgggcacccaagccg
taccacaagttcatggctttcaagtccttcggcgaccttcttcacaaacccttgatggtc
gacctgacgatagaagaggacagcaggctcaaggtcatctacgggtccggagcgggattc
cacgccattgacctcgacacatcggcagtgtacgacatctacatccccacacatatctcc
agtgggatcctgcctcatgccatcatcaccctaccaaactccaaaggaatggaccttctg
ctgtgctatgaagacgagggggtgtatgttaatacatatggcaaagtcatcaaggacatc
gttctacagtggggagagatgcccacatctgttgcatatatagggacagggcagatcatg
ggatggggacagaaggctatcgagatccggtcagtcgagactggacatctggacggggtc
ttcatgcacaagagggcacagagactcaagttcctgtgtgagaggaatgacaaggtcttc
tttgcatccactcgctcgggatccagcagtcaagtctacttcatgacacttaacaaaatc
caatggtaa

DBGET integrated database retrieval system