KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_277757Help
Entry
BRAFLDRAFT_277757 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K07376  cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Module
bfo_M00694  cGMP signaling
Brite
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     BRAFLDRAFT_277757
Protein kinases [BR:bfo01001]
 Serine/threonine kinases: AGC group
  PKG family
   BRAFLDRAFT_277757
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase cNMP_binding Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 7225113
NCBI-ProteinID: XP_002610348
JGI: 277757
UniProt: C3XZZ2
AA seq 573 aa AA seqDB search
MLKEAIQQNDFMKNLDPIQVSEIVDCMDFQMFQSGQKVIQEGEAGQQLFVAEVGDLQVTK
GGKYLGNMGPKTLFGELALLYNCSRTATVKAVTESKLWAIDRNIFQMIMIKTGRTRREEH
FKFLKSVSLLKELPHAKLSKIADCLEVDFYHEGEYIIREGQTGDTFFIIIEGEVKVTQKI
EGEEEPKLTRRLGRGETFGEKALLSEEKRTANVIAVGGVKCLTLDRVVFNQLIGQLSEIK
KVDEHDQVNGPAQEQLMYAKVPLDDLDIVATLGVGGFGRVELVKWQDKSFALKCLKKKHI
VNTRQQEHIYSEKAIMMSCNSPFITKLFKTFKDTRYVYMMMEPCLGGELWTILRDRGSFD
DHTTRFCTACVVQAFTYLHGRGIIYRDLKPENLLLDQRGYVKLCDFGFAKKIGFGHKTWT
FCGTPEYVAPEIILNKGHDYSADVWSLGILMFELLTGTPPFSGSDPMKTYNLILKGIDAV
EFPRKIGKNANNLIKKLCKENPSERLGYQKNGMNDIKKHKWFQGFDWDGLTTQSTQPPIV
PKVRGPSDTSNFDKYSRETDIPPEEMSGWDTDF
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaggaagcgatccagcagaatgacttcatgaagaatctggacccgatccaggtc
agcgagatcgtggactgcatggacttccagatgttccagtccggacagaaggtcatccag
gagggcgaggccggccagcagctatttgtggcagaagttggtgacttgcaggtgacaaaa
ggagggaaatacctgggcaacatggggccaaagacactgttcggagagctggcactcctt
tataactgtagcagaacagccactgtcaaagctgttactgagtccaagctgtgggccata
gacaggaatattttccagatgatcatgatcaagacagggagaaccaggagggaagaacac
ttcaagtttctcaagagcgtctccctgttgaaagagctaccacatgccaaactgtccaag
atagccgactgccttgaagtggacttctaccatgaaggggagtacatcatcagagagggc
caaaccggagatactttcttcatcattattgagggggaggttaaggttacccagaaaata
gaaggagaggaggagccaaaactgaccagaagactgggacggggagaaacgtttggagag
aaagcacttctcagtgaagaaaaaagaaccgcaaacgtcatcgctgtaggaggggtgaaa
tgccttacgcttgacagagtagtcttcaaccagctgattggtcaacttagcgagattaag
aaggtggacgagcatgaccaggtgaacggcccagcacaggagcagctgatgtatgccaag
gttccactggatgatctggacatcgtggccactctgggtgtgggagggttcgggagggtc
gagctggtgaagtggcaggacaagtcgtttgccctgaagtgccttaagaagaaacacatc
gtcaacaccagacaacaggagcacatctactcggagaaggccattatgatgtcctgtaac
tcacccttcatcacaaagttgtttaagacatttaaggacaccaggtatgtgtacatgatg
atggagccgtgtctggggggagaactctggaccatattaagagacagaggttcgttcgac
gaccacacaacacggttctgcacagcatgcgtggttcaggccttcacgtacctgcacggc
agaggcatcatctacagggacctgaaacctgagaacctgctactggaccagaggggatac
gtcaaactgtgtgactttggctttgccaagaagatcggatttgggcacaagacgtggacg
ttctgcggcacgcctgagtatgtggcgccagagatcatcctgaacaaagggcacgactac
tctgctgacgtctggtcacttggtatcctcatgtttgagctgctcactggaacgccaccg
ttttccggctccgaccccatgaagacctacaacctgatcctgaagggcatcgatgctgtg
gagttccccagaaagatcggcaaaaacgccaacaatctcatcaagaagctatgcaaagag
aacccttcagagaggttgggctatcagaagaatggaatgaatgacatcaagaaacacaag
tggttccagggttttgactgggatggactcaccacacagtcaacacaacctcccattgtt
ccaaaggtgcgagggccaagtgacacaagtaacttcgataaatactcccgagagaccgac
atccctcccgaggagatgtctggatgggacacagacttctag

DBGET integrated database retrieval system