KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_287036Help
Entry
BRAFLDRAFT_287036 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00350  Tyrosine metabolism
bfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    BRAFLDRAFT_287036
Enzymes [BR:bfo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     BRAFLDRAFT_287036
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BRAFLDRAFT_287036
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 Cons_hypoth95 GCD14 CmcI Met_10 Methyltransf_31 PCMT Methyltransf_25 Methyltransf_4 LcnG-beta
Motif
Other DBs
NCBI-GeneID: 7215874
NCBI-ProteinID: XP_002594676
JGI: 287036
UniProt: C3Z9J1
AA seq 263 aa AA seqDB search
MESTTSAVLSAVTGTVAMTAAYAYAQRDWLKDQWLAFISPAIYNFLKGTTREQRGPKYLK
EHARQGDPDSVLETFDEFCRTQEWAMNAAEEKGDILDEIVRELQPTTCLELGTYCGYSAV
RIARNLSPSARLITIEVNPDYAAVAREVVKLAGLQDKIEVINLDSADVIRELKTKYDVTK
LDLVFLDHWKYLYIRDIKLIEEEKLLKKGSVVFADNVIIPGAPGYLEYIRGSKNYKSTFY
SVHFEYMDDMKDGVEKSVYIGDE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggagtccaccacatcagcggtgttgagtgcagtgacgggaacggttgccatgacagca
gcctacgcgtacgctcaacgggactggctgaaggaccaatggctggccttcatctccccc
gccatctacaactttctaaagggaacaacaagggagcagcgcggccctaaatacctcaag
gagcacgcccgacaaggagatcctgacagcgttctggaaacgtttgacgagttctgcagg
acccaggaatgggccatgaacgcggcggaggagaaaggcgacatcctggacgaaatagtg
cgtgagctgcagccgaccacatgcctggagctggggacgtactgcggctactcggcggtt
cgcattgcccgaaatctgtctccctccgcccgcctcatcaccatagaagtcaacccggat
tatgccgcagtggccagggaagttgtaaagcttgctggtctacaggacaagatcgaggtc
atcaaccttgacagcgctgacgtcatccgagagctgaagaccaagtatgacgtcacgaag
ctggacctggttttcctggatcactggaagtacctctacatccgggacatcaaacttatc
gaggaagagaagttgttgaagaagggatctgttgtttttgcagataacgtcattattcca
ggagctcccggttatcttgagtacataagaggctccaagaactacaagtcgactttctat
tctgttcattttgagtatatggatgacatgaaggatggtgtggaaaagtcagtgtatatt
ggtgatgagtaa

DBGET integrated database retrieval system