KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_63924Help
Entry
BRAFLDRAFT_63924  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K11842  ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     BRAFLDRAFT_63924
Peptidases [BR:bfo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   BRAFLDRAFT_63924
Ubiquitin system [BR:bfo04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    BRAFLDRAFT_63924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 Peptidase_C98
Motif
Other DBs
NCBI-GeneID: 7207825
NCBI-ProteinID: XP_002611444
JGI: 63924
UniProt: C3XXJ4
AA seq 349 aa AA seqDB search
MGANASQLEKEIGSDQFPVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLQYKAQPK
KKETLLTCLSDLFHSIATQKKKVGVIAPKKFIARLRKENELFDNYMQQDAHEFLNYLLNT
VADLLQAEKQQAKGINGTDNNTKSDPTWVHDIFQGTLTNETRCLCCETVSSKDEDFLDLS
VDVDQNTSITHCLRGFSNTETLCSEYKYYCEMCCSKQEAQKRMRVKKLPMILALHLKRFK
YMEQLHRYTKLSYRVVFPLELRLFNTSDDAVNADKIYDLVAVVIHCGSGPNRGHYITIVK
SHGFWLLFDDDIVEKIDAHAIEDFYGLTSDIQKTSESGYILFYQSRDSS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgggagcaaatgcgtctcagcttgagaaggagattggttcggatcagttcccggtgaat
gaacactacttcggattggtaaattttgggaacacgtgttactgtaactcagtgctccaa
gcgctgtacttctgccggccgttccgggagaaggttctgcagtacaaggcccagcccaag
aagaaggagacgctgctcacctgcctgtccgacctcttccactccatcgccacgcagaag
aagaaagtcggcgtcatcgcgcccaagaagttcatcgcaaggttgagaaaagaaaatgag
ttgtttgacaactacatgcagcaagatgcacacgagttccttaactacctactcaacaca
gtagcggatctgctacaagcagagaaacaacaagccaaaggcatcaacgggacagacaac
aacaccaagtcagaccccacctgggtccatgatatcttccagggaacgctaaccaacgag
accaggtgcctctgctgtgagacggtcagcagcaaagatgaggatttcctggacttgtca
gtagatgtggaccagaacacgtctatcacccactgtttaaggggcttcagtaatacagag
acgttgtgtagtgagtataagtactactgtgagatgtgctgcagcaagcaagaagcacaa
aaacgtatgagagtgaaaaagctgcccatgatcctggctctgcacctgaagaggtttaag
tacatggagcagctgcaccgctacaccaagctgtcctacagggtggtgtttcctctggag
cttagactgttcaacacgtcggatgatgcagttaatgcagataagatatacgacctggtg
gccgtggtcatccactgtggcagtggacctaaccggggccattacatcaccattgtcaag
tcccacggcttctggctgctgtttgatgatgacatcgtggagaaaattgacgcccatgca
atcgaagacttctacgggctgacatcagatatacagaagacatcggagtcgggttacatc
ctcttctatcagtccagagacagtagttag

DBGET integrated database retrieval system