KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_65130Help
Entry
BRAFLDRAFT_65130  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K13937  hexose-6-phosphate dehydrogenase [EC:1.1.1.47 3.1.1.31]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00030  Pentose phosphate pathway
bfo01100  Metabolic pathways
bfo01200  Carbon metabolism
Module
bfo_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bfo_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BRAFLDRAFT_65130
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     BRAFLDRAFT_65130
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     BRAFLDRAFT_65130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C Glucosamine_iso G6PD_N
Motif
Other DBs
NCBI-GeneID: 7213453
NCBI-ProteinID: XP_002594276
JGI: 65130
UniProt: C3ZBQ0
AA seq 804 aa AA seqDB search
MQEVCYKTGCDNMAASAAVRRAAAVVFLITVLSTKQTYSKHTNVVLVGATGDLAKKYLWQ
GFFDLYQAEHAEGNTFSFYGGGRNNVEAGGPLLQEIVTESRKCSTEIDSCIQHRENFVEM
VKYHRLKSEDDYTELCKTIEENLKQSELEERGRFFYLSVPPFAYPSVSANIHKFCRPKEP
EAWLRVVVEKPFGHDLQSAEELVESLSEFFSEEELYRVDHYLGKQAVEEILPFRRGNWDL
EAMWNTEHVERVEIVMKETIDVKGRLSFFDSYGIIRDVLQNHLTEILTLVAMDTPQRGNL
SDFQQKKLDLYSQIQPLTSEGSLIGQYEEYNSQWQEELKKEDKDSSQSATFAAVVFTINS
DRWKDVPFVVTAGKKLDERVGYVRVVFRKLLADENCIERACPHNQVIFHIGHGKLKVPAV
LVSKGLPKPVVPMGWVEYEPPADMEIFDLPASAYHVYSPEVIRDAYSSLIESVYRGQSDR
FVSSPHLLASWRIWTPLLKELEEKEPRKYPGGKEDSTLQYVLVDDKLYFLSDLIVDRSDA
FAFSTSSSTGTLNLATLPSLFRGQRLVSGESDKVITQLANDIKDIALQTLQTKELFHIAF
SGGKSPLKLLNYLVLESERMGFPWKQTLIWFVDERCVPHNDERSNFHFVEKNLLRYLDIP
MYNVNPMPVGGAYEECDVNGADQHHSKVSNILDGAFDYVLLGVGSDGHTASLFPGSPALQ
EREKYVAITDATGDVEVKQRMTLTFKSINKSGNVGVLLLGKGKHGIVKKLQDGGVDVEKL
PITGVKPKQDSMTWYIDHQALFGQ
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaagtgtgctacaaaactggttgtgacaacatggctgcatcagctgctgtcagg
agggcagcggccgttgtcttcctcatcacagtcctctctacaaaacaaacatacagcaaa
cacacaaatgtagtccttgttggagctacaggggatctggctaagaaatatctatggcaa
ggcttctttgacttgtaccaggcagaacatgcagagggaaacaccttttctttctatgga
gggggtaggaataatgtagaggcaggcgggccacttttacaagagatcgtaacagagagt
aggaaatgttccaccgagattgatagttgtattcagcacagggaaaactttgttgaaatg
gtgaaataccatagactgaagtcggaagacgactacacagaactgtgcaaaaccattgaa
gagaacctcaagcaatcagagctagaagaacgtggcagattcttctacctctcggtgcct
ccgtttgcttatccgagtgtttctgccaacatacacaagttctgcaggcctaaggaacct
gaggcttggttgcgagtcgtggtggagaaaccatttggacacgacctacagtccgcagaa
gaactggtggagagtttgtcagagttcttctcagaggaagagctgtaccgggtggatcac
tacctggggaagcaggcggtggaggagatcttgccgttccggcgagggaactgggacctg
gaggccatgtggaacacggagcatgtagagcgggtggagatagtcatgaaagagaccatt
gatgtgaaaggtcgactgagcttctttgacagctatggcataatcagggacgtccttcag
aaccacttgactgaaatcctgactctggttgccatggatacgccacagagaggtaacctc
agtgacttccagcaaaagaagctggacctttacagccaaatccaacctttaacttcagag
ggctctctcattggtcagtatgaagaatacaacagccaatggcaggaagagttgaaaaag
gaagacaaggacagcagccaatcagcaacttttgctgcagtggtctttaccataaacagt
gacaggtggaaggacgtgccatttgtagttacggccggtaaaaagctagacgagagagtt
ggatatgtcagagttgtgttcaggaagctgctagctgatgaaaactgtatagaaagggca
tgtcctcacaatcaggtgattttccatattggacatggcaaacttaaagtccctgcagtg
ctagtctcaaagggccttcccaaaccagtagtgccaatggggtgggttgagtatgaacca
cctgcagacatggagattttcgatctccccgccagtgcctatcatgtctactcccccgaa
gtcatcagggatgcgtacagttcccttattgagtccgtgtaccgtggccagagtgaccgt
ttcgtcagctccccacacttgctcgcgtcttggagaatctggactcctctcctgaaagaa
ctggaagaaaaggaaccaaggaaataccctggtggaaaggaagactcaacactgcagtac
gtgttagttgatgacaagttgtatttcctgtcagatctcatagttgatagaagtgatgca
tttgcattctcaacatcctcttcgaccggtactttgaacctggctactctaccatccttg
tttaggggtcaaaggttagtctcaggggaaagcgacaaagtcatcactcaacttgccaac
gatatcaaagacatagccttacaaactctccaaacaaaagagcttttccacatcgcattc
tcgggtggtaagagtcccctaaagctgcttaactaccttgtcctggagtcggagaggatg
gggttcccatggaaacagacccttatttggtttgtggatgagcgatgcgtcccccacaac
gacgagaggtcaaacttccactttgtggaaaagaatctcctgcgctacctcgacatccca
atgtacaatgtgaaccccatgccagtgggtggggcttatgaagagtgtgacgtgaacggg
gcagaccaacatcacagcaaagtctcaaacatcctcgacggtgcctttgactacgtctta
ctaggggtggggtccgacggacacacagcctccctcttcccaggatcccctgcactgcag
gagcgagaaaagtatgtcgcaatcaccgacgcaacaggagacgtggaggtcaaacagaga
atgaccttgacgtttaagtcaatcaacaagtcagggaatgttggagttctcctccttgga
aaagggaagcatggcattgttaagaagctgcaggatggaggggttgatgtggagaagtta
cccataactggagttaagccaaagcaggacagcatgacttggtacatagaccaccaagcc
ctctttgggcagtag

DBGET integrated database retrieval system