KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_68763Help
Entry
BRAFLDRAFT_68763  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K11252  histone H2B
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Chromosome and associated proteins [BR:bfo03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    BRAFLDRAFT_68763
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BRAFLDRAFT_68763
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like CENP-W CENP-T_C DUF1931
Motif
Other DBs
NCBI-GeneID: 7223654
NCBI-ProteinID: XP_002599159
JGI: 68763
UniProt: C3YWC7
AA seq 122 aa AA seqDB search
MAPGISKKGEKKAGKSRMGGTMERRKKRKRKETYSVYIYKVLKQVHPDTGISSKAMNIMN
SFVNDIFERIASEASRLAQYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS
SK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggctcctgggatcagcaaaaagggtgagaaaaaggcgggaaagtccaggatgggcggt
acaatggaaaggagaaaaaagagaaagaggaaggagacctactcagtctacatctacaaa
gtcttgaaacaggttcatcctgacacgggcatctccagtaaggccatgaacatcatgaac
tcttttgtgaacgacatcttcgagcggatcgcctcagaagcctcgcggttggcccagtac
aacaaacgatccaccatcaccagtcgggagatccagaccgctgtgcggctgctactgccc
ggagagctggccaaacacgccgtcagcgaaggcaccaaggccgtcaccaagtacaccagt
tccaaatag

DBGET integrated database retrieval system