KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_83774Help
Entry
BRAFLDRAFT_83774  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bfo01002]
    BRAFLDRAFT_83774
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     BRAFLDRAFT_83774
Peptidases [BR:bfo01002]
 Serine Peptidases
  Family S33
   BRAFLDRAFT_83774
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Thioesterase Chlorophyllase2 Chlorophyllase Esterase Lipase_3 SPA
Motif
Other DBs
NCBI-GeneID: 7234862
NCBI-ProteinID: XP_002590589
JGI: 83774
UniProt: C3ZLG3
AA seq 329 aa AA seqDB search
MEAISAVVQLAGGAVLTTLALAVFVMYTQPANIVHFFLRLNKWRTGCTTKYVKVGEQQFA
YMERGRPSENQPSLLFLHGFSDRKETYCEIIMHLPKHLHLIAVDLPGHGDTGIKAKADLT
VEAYAAKLHQFISEVDLNHGPLHVVGHSMGGGLAGCYAATYPEKMWALTMICPGGIKVPE
NSVMFEKIFRGNKHVMIPETVEQAEEMFNICLYNKSLIPPKRVLQGYVDYSKPYIDFNKE
LFDAMLELGQDGLTPYLGKISAPTQVMWGRHDKALHIAGLDVIKREMSAPLQVDVIEDCG
HTVGLEAPKKAATFLLNFRETVLNKENRT
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggaggccatctctgcagttgtccagttggctggaggagccgtactgaccactctggcc
ttggctgtctttgtcatgtacacccaacctgccaacattgtgcacttctttctgaggttg
aacaaatggaggacgggctgtaccactaagtacgtgaaagtgggggagcagcagtttgct
tacatggagaggggtcggcccagtgagaaccaaccatcgctgctcttcctgcatggcttc
tccgacaggaaggagacttactgtgagatcatcatgcacctgcccaaacacctgcacctg
attgctgtagacttacctggacatggagacaccggcatcaaggcgaaggctgacctgact
gtagaggcctatgctgccaagctgcaccagttcatcagtgaagttgaccttaaccatggc
cccctgcatgttgttggacactccatgggtggcggccttgctggttgctatgcagctacg
taccctgagaagatgtgggctctgacaatgatatgtcctggtggtataaaggtgccagag
aacagtgtaatgtttgagaagatcttccgaggaaacaaacacgtgatgatccctgagact
gtggagcaggcagaggaaatgttcaatatctgtctgtacaacaagtcactcatacctccc
aaacgggtattacaaggatatgtggactactccaaaccatacatagacttcaacaaagaa
ctgtttgatgctatgttggaacttggacaagatggactgacaccttaccttgggaagatc
tctgcaccaacacaggtgatgtggggaagacatgacaaggccctccacatcgccggcctg
gatgtgataaagagagagatgtcagcacctctgcaggtggatgttatagaggactgtgga
cacaccgttggcttagaagctccaaaaaaggctgctacttttctgttgaacttcagagaa
actgttctcaacaaggagaatagaacttag

DBGET integrated database retrieval system