KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_84578Help
Entry
BRAFLDRAFT_84578  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K16857  thrombospondin 1
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo04145  Phagosome
bfo04350  TGF-beta signaling pathway
bfo04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    BRAFLDRAFT_84578
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    BRAFLDRAFT_84578
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    BRAFLDRAFT_84578
Membrane trafficking [BR:bfo04131]
 Endocytosis
  Phagocytosis
   Opsonins
    BRAFLDRAFT_84578
Glycosaminoglycan binding proteins [BR:bfo00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   BRAFLDRAFT_84578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 TSP_1 EGF_3 VWC cEGF EGF_CA zf-CCCH_2
Motif
Other DBs
NCBI-GeneID: 7234073
NCBI-ProteinID: XP_002613442
JGI: 84578
UniProt: C3XRY3
AA seq 1158 aa AA seqDB search
MYDLFESTSLGASTQGVKKVRGLDQYSPAYKFHNRPDVDLPASPQAQARIVDAMMSNHGF
VFVAALRQDRRNRGTLVSVDSPDGRTRYFGIQSDGQTPSVDVVYMHEGKEVAASFDGVNF
ATREWRNLTLVVQGDLIALFDGCTKVGEQGLMGNIFQTVLQPGQSELRLGKGLPGREAFE
DYRGVMQSVKFIFGIPVSNILHLQGCAPDTGSEYNTGNITQTAAAVSSVLTRKFKLIPQP
SDECEVACEDLDDLKKQIKDLRIHLNNVEDGLQKMWEENNILRKQIGAPPHGGCWAEGRY
YGNNVHWVENRCTKCHCQDSRTTCQKIECRAVQCVNPVFDSETDCCPYCPLSGDDAEVGW
SLWSDWTPCSASCGPGTQQRGRSCDRVNYPCDGPSVETKVCLQDDCDNRIPMNGGWSLWT
PWTCSVSCGEGITTRIRTCNAPTPQLGGENCLGDGRENNICEREACPVHGQWGQWSLWGP
CSRTCDGGTRVRRRLCDSPAPAYGGDKCQGQPADVDHCNTEPCPIDGCLSNPCFAGVECS
STKDGKYTCGPCPAGFEGDGSSCTDIDECALVPDTCYIHNGVSLCKNLGPGYRCQRCPPG
YTGNQPGGVGIFMAESNKQTCLPANPCRDGTDQCHFNAECKFLGPFIDPLYECQCKVGYA
GNGIHCGEDIDLDGYPDEDLPCLIGNTTHCKKDNCPFLPNSGQEDFDKDGKGDACDRDDD
NDGIPDVRDNCPMAFNARQDDYDRDGWGDLCDNCPYDQNFYQKDTDGNGEGDACSVDIDG
DGLRNEADNCPLHANIRQEDADGDGVGDQCDNCPVIANPKQEDSDSDLWGDACDNNIDVD
DDGLENIRDNCPSIPNSNQINHDGDNFGDACDEDDDNDGILDHLDNCRLRANPDQIDSNG
DGRGDVCQEDFDGDGVKDKDDVCPENAQISRVDFRDFQMVALDPKGTSQIDPNWVIRNQG
KELVQTVNSDPGMAIGIDKFNEVDFDGTFYVNTQKDDDYAGFVFGYQSSHRFYVVMWKQV
HQTYWLSKPSMAHGSAGVQVKVVNSETGPGEALRNALWHTGDTPGQVRLLWHDKNTTGWK
DMTAYRWKLKHRPDSGLIRVTFYEGSKVMADSGDLFDTTLKGGRLGLFVFSQEMVFFSDL
KYNCGQSALGEMKGSESP
NT seq 3477 nt NT seq  +upstreamnt  +downstreamnt
atgtatgacctgtttgaatcgacgagtctcggggcgagcacacagggagtgaagaaagtg
cgggggctcgatcagtattcaccggcctacaagttccacaaccgtcccgacgtcgacttg
cccgccagcccccaggcgcaggccaggatcgtcgacgcgatgatgtcgaaccatggcttt
gtgttcgtcgcggcccttcggcaggaccggcggaaccgtggcacgctcgtgtccgtcgac
tcgcccgacggcaggaccagatacttcggcatccagagtgacggccagacgccctccgtg
gacgtcgtgtatatgcatgaaggcaaggaagtcgcggcctcgttcgacggcgtgaacttc
gccacgcgggaatggcgcaacttgacgttggtggtgcagggagacctgatcgcgctgttc
gacggatgtaccaaggttggcgagcagggcctgatggggaacatcttccagaccgtcctc
cagcccggacagagcgagctccgtctggggaagggcctacccggcagggaagccttcgag
gattacaggggtgtgatgcagagtgtgaagttcatctttggaatcccggtgtccaacatc
ctccacctgcagggctgtgctcccgacacagggtcagaatacaacacgggtaacatcacc
cagactgctgctgcggtgagcagtgtcctgacgaggaagttcaagctcatcccccagcct
tcagacgagtgtgaggtcgcctgcgaggacctggacgacttgaagaaacagatcaaggac
ctgaggatccacctgaacaatgtggaagatgggctgcagaaaatgtgggaagagaacaac
atcctgaggaaacagatcggtgctcctccgcatggtggatgctgggcagaaggacgttac
tatggcaacaatgtacattgggtggagaaccgctgtaccaagtgtcactgtcaggattcc
agaactacatgtcagaagatcgagtgccgtgcggtccaatgtgtcaacccagttttcgac
agtgagactgactgttgcccatactgccctctcagtggagacgacgcggaggtcggatgg
agcctgtggtctgactggacaccgtgcagcgcttcttgcggacctggcacccagcagcga
ggccgatcatgtgaccgtgtcaactacccctgtgacggccccagtgtagagaccaaagtg
tgcctgcaggacgactgtgacaacagaattcccatgaatggaggctggagcttgtggact
ccctggacctgctctgtgtcctgtggggagggcatcaccactcgcatcaggacctgcaat
gcacccactccacagctaggtggcgagaactgtcttggagatggacgagagaacaacatt
tgcgagagggaggcatgccctgttcacggccagtggggtcagtggtcactgtggggccca
tgctcgcgcacctgtgatggaggcaccagggtccgccgccgtctctgcgacagtcccgca
ccagcgtacggaggggacaagtgccagggccagcctgctgacgtggaccactgcaacacc
gagccttgccccattgatggttgcttatccaacccctgctttgccggagtggaatgttcc
agtaccaaggatggcaagtacacgtgtggtccctgtcccgctggcttcgagggtgacgga
tcttcttgcactgacattgatgagtgtgcactggttcctgacacctgttacatccacaac
ggagtgtccctgtgtaagaacctggggccaggctacaggtgccagaggtgtcctcccggc
tacacaggaaaccagccaggtggagtgggcatcttcatggcagagagcaacaaacagacc
tgcctgcctgccaacccctgcagagatggtactgaccagtgccacttcaacgctgagtgc
aagttcctgggaccgttcatagatcccctgtacgaatgccagtgcaaggttggatatgct
gggaacggcatccactgtggtgaggacatcgacttggacggttatcctgacgaggatctg
ccctgtttgatcgggaacacaacgcactgcaaaaaggacaactgcccattcctacccaac
agtggtcaggaggactttgacaaggatgggaagggtgatgcttgtgacagagatgatgat
aatgacggcatccctgatgttagggacaactgcccgatggcgttcaatgccagacaggac
gactacgaccgtgatgggtggggagacctgtgtgacaactgcccctacgaccagaacttc
taccagaaggacacggatggcaatggagagggagatgcctgctctgtggacatagatggt
gatggactgaggaatgaagctgacaactgccccctgcatgccaacatcagacaggaggat
gctgatggtgacggtgttggagaccagtgcgacaactgccctgtcatcgcaaaccccaaa
caagaggactctgactccgacctgtggggcgatgcctgcgacaacaatatcgatgtcgat
gacgacggtctggagaatatccgtgacaactgcccgagcatccccaacagtaatcagatc
aaccatgatggcgacaattttggtgatgcgtgtgatgaagatgatgacaatgacggtatt
ctggaccatttggacaactgcagactccgtgcaaacccagaccaaatagacagcaacggt
gacggacgtggagacgtttgccaggaagactttgacggtgacggtgtcaaggacaaggat
gatgtgtgcccagagaatgcgcaaatctccagggtagacttccgtgacttccagatggtt
gcactggatccaaagggaacatcccagattgaccccaactgggtcatcaggaaccaaggg
aaggagctggtgcagacagtcaacagtgatccaggcatggcaataggaattgacaagttc
aacgaagtggactttgacggcaccttttatgtgaacacgcaaaaggatgatgactacgca
ggctttgtatttggctaccagtccagccatcggttctacgtggtgatgtggaaacaggtc
caccagacgtactggctgtccaaaccttccatggcccacggctcagcaggagtccaagtc
aaggtggtaaactcggagacaggaccaggtgaggccctgaggaatgccctgtggcacact
ggagacactcccggacaggtgaggctgctgtggcacgacaagaacaccactgggtggaaa
gacatgaccgcctacagatggaagctgaagcacagaccagactctggactaataagggtg
acattctatgaaggcagtaaagttatggctgactctggggatctattcgacacaacatta
aagggaggtcgcctaggacttttcgtcttttcacaagagatggtcttcttctcggatctg
aagtacaactgtggtcagtcagccttgggggaaatgaaaggaagtgaaagtccttaa

DBGET integrated database retrieval system