KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_85494
Entry
BRAFLDRAFT_85494  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bfo03036]
    BRAFLDRAFT_85494
Chromosome and associated proteins [BR:bfo03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    BRAFLDRAFT_85494
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank_3
Other DBs
NCBI-GeneID: 7240973
NCBI-ProteinID: XP_002608932
JGI: 85494
UniProt: C3Y3R6
AA seq 826 aa
MASEGQSHRDRRTSAVGAGRTVLPRRRTRRVVAVTKKKIVDDEFMAAAIGDVKWLEQSLR
DGRSPTAMDKNVRQLYDNLSGGARCYFVPEQGLATIHLAALHGRLECLKLLIEKYKVDVD
FPSSTGWRAVHLVINKETGKRAHKCLQYLLEQGADPSVMNDDSLTPVHQAASEGLVDCLQ
LLIDNRGVVDVIDVRGHRPIDLAKLWGHRKCARMLASVMWSQEKEFFAKEMRQLGQVTAK
YWDFERDTAETKRAEQDFYGQVAFGNWIDDKGLPPKLKQMDFLSRPEQFPAKPSTTKSKT
STRSGEGTTTGSGFYRPNSKVAAPVAASEGLVDCLQLLIDNRGVVDVIDVRGHRPIDLAK
LWGHRKCARSVSSYLHIARKGYIMLTMWSMGRRRKMIMNEVKIKAILYRVIYRKQQQHCL
CPKYLSSFCVNTFDRKTVSSSDRDRCTIVCVSDPQTVSFRMLASVMWSQEKEFFAKEMRQ
LGQVTAKYWDFERDTAETKRAEQDFYGQVAFGNWIDDKGLPPKLKQMDFLSRPEQFPAKP
STTKSKTSTRSGEGTTTGSGFYRPNSKVAAPVVSSSKKEEILGGIQTTTQKVPVREQGLR
PRTQPPPEIIEPPMSPPKSPASPRKDMKLIHTKEWKPFFTNIESEPKTDIFRPHEVRRSV
EPEDNDPFSGLRRTKSQPITSHQGYDLAEVERPVTSGGLRMPVLPEEVIRRGLSRQRLPH
ERIKMPQEFKCVNIIDVQQKRLPEPEVRQGEAAMHLAQTLESNLFQLAVGDNRMNTGSSS
TATSSTDIQYSREKVLNTMKRLQKPRPFPAMPGPDYVLNLSGTMGM
NT seq 2481 nt   +upstreamnt  +downstreamnt
atggccagcgaagggcagtcccatagggaccggaggacgagtgcggtcggggcggggagg
acggtgttgccgaggcggcgcactcggcgggtcgttgccgtcaccaagaagaaaatcgtg
gatgacgagttcatggctgccgcgatcggcgacgtcaagtggctggagcagagcctgagg
gacgggagatctcccacggccatggacaaaaacgtaagacaattgtacgataatttatca
ggtggggccagatgttattttgtgcctgaacagggtcttgcaaccatccatctggctgcc
cttcatggccgtctggagtgcctgaagctcctgatagagaagtacaaggtggatgtggac
ttcccaagcagcacaggctggcgggcagttcatctggtcatcaacaaggagacaggcaag
agggctcacaaatgtctgcagtaccttctggagcagggagcagacccttctgtcatgaat
gatgacagcctgacacctgtccatcaggcagccagcgaggggctggttgattgccttcaa
ctgctgattgataatagaggagtggtcgatgttattgacgtcagaggtcatcgacctatt
gaccttgccaagctgtggggtcacaggaaatgtgcaagaatgcttgcatcagttatgtgg
tcccaagagaaagagttctttgccaaggagatgaggcaacttgggcaagtcactgctaag
tactgggactttgaacgggacacagcagagacaaagcgtgccgagcaggatttctacgga
caggtggccttcggtaattggatagatgataaaggccttcctccaaaactcaagcagatg
gacttcctctcacgcccagaacagttcccagcaaagcccagcaccacaaagtctaaaacg
agcacccgatcaggggagggcactaccactggctctggattttatagaccaaacagcaaa
gtagcagcacctgtggcagccagcgaggggctggttgattgccttcaactgctgattgat
aataggggagtggtcgatgttattgacgtcagaggtcatcgacctattgaccttgccaaa
ctgtggggtcacaggaaatgtgcaaggtcagtgtcttcctacctgcatatagccaggaaa
ggctacatcatgttaaccatgtggtccatgggtaggaggaggaaaatgataatgaacgaa
gttaaaattaaagcaatattatatagagttatatatagaaagcagcagcagcactgcctg
tgtccaaagtatcttagttctttctgtgttaacacatttgacaggaagactgtcagcagt
tcagatagagatcgctgtacaattgtctgtgtcagtgaccctcaaactgtctctttcaga
atgcttgcatcagttatgtggtcccaagagaaagagttctttgccaaggagatgaggcaa
cttgggcaagtcactgctaagtactgggactttgaacgggacacagcagagacaaagcgt
gccgagcaggatttctacggacaggtggccttcggtaattggatagatgataaaggcctt
cctccaaaactcaagcagatggacttcctctcacgcccagagcagttcccagcaaagccc
agcaccacaaagtctaaaacgagcacccggtcaggggagggcactaccactggctctgga
ttttatagaccaaacagcaaagtagcagcacctgtggtgtccagctccaagaaagaggag
attttggggggtatacagaccaccactcaaaaggttccagtacgagaacagggcctgagg
ccccgtacccaaccgccaccagagatcatagagcccccgatgtctccccccaaatcccct
gcttctcccagaaaggacatgaagctcattcacacaaaggaatggaagccattctttaca
aacatagagtcagagcctaaaactgacatcttccgtccacatgaggtgcgccgaagtgta
gaaccagaggacaatgaccccttctcaggtctccgacgcaccaaatctcaaccaatcaca
agccatcagggctacgacctggcagaggttgagaggccggtgacatccggtggcctgcgc
atgccagtgttgccagaagaggtgatccggcgaggcttgtcacgacagcggttaccgcac
gaacggatcaagatgcctcaggagttcaagtgtgtgaacatcattgacgtccaacagaag
aggcttccagagcccgaggtgcgacagggtgaggcagccatgcatctggcccagacgctg
gaatctaacttgttccagctggctgttggagacaataggatgaacaccggcagctcctca
acagcgacctctagcaccgacatccagtactccagggagaaggtgttgaacacaatgaag
aggctgcagaagcctcggcccttccctgcaatgccagggcctgactatgtgttgaacttg
agtggaaccatggggatgtag

DBGET integrated database retrieval system