KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_88413
Entry
BRAFLDRAFT_88413  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K15195  AF4/FMR2 family member 3
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bfo03021]
    BRAFLDRAFT_88413
Transcription machinery [BR:bfo03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     BRAFLDRAFT_88413
SSDB
Motif
Pfam: AF-4_C NAD_binding_11 NAD_binding_2 Prot_ATP_OB_N
Other DBs
NCBI-GeneID: 7247518
NCBI-ProteinID: XP_002611188
JGI: 88413
UniProt: C3XWT8
AA seq 1803 aa
MQKSLTEHPSTNLVFGTSGVLQSIRPGKAYVEMSTIDVETVQDVAESIESRGGRFLEAPV
IGTRKPAEDGMLVIVAGGDRSLFDDCESCFLAMGKKAFYLGEVGSGTRMKLVANMVLGSV
MAGYAEGMSLAERAGLDLQTVLDVFKEGPLNCAAVRSKGDAILHSRFEPSFPLKHQQKDM
RLALALGDELKQSLPVAAAANELVVLLNVEKCSVYSAVVVVSGSVDRVELRRQAQLQRAG
MKVSTETPAVSKPLFDAPVKIDPPPDDHVYRKTQNNFPHVCSRLTPLPTTICTIDPPPDD
HVYRKTQNNFPHVCSRLNPLLTTLCTPDSSSSASSSIKMEASSTKDDAFQMPAPLSTAPG
SHRPSHSGGKAGDRPEERPNGLLAAPGHGGKKEGVEKELSREDVKRKLTLTMPDTSEEAR
LNSSGGLKSAGTEKVEIILKGRNCVYHPQSRVRAPVVVGYRRTRLDVSPDEDRMLLSPGE
VVRITLLDFAGVCPPRNENPIISYEDLIADEVPALGAEAQEMTEVGPPLTGIHTPIKTDV
SKFPFPANQDVPSAQLSRTKRKTTAESSGGGKTKPMGPSSEPKWGIGSIIPRDQWVLVTA
CHPQASRWAGGKAPVPACLRCAFIAVCRVNTLVGGSFGREPLGLWGRDKAGSSAGGDFSS
RRFTGSSAPWLKKYFLDMSDSEDDDDQARQTKTAGRNAQKMSVGAVLSFNAPEVLTDHRD
LPGHIGRFQSGDLLTVLSANESRCPSVNRRSGRSCEKKSGHVSVVGIYHGLLPAWSGDPT
CDEGSSSSDESVQDAPPPASPPKCDEGSSSSDESVQDAPPPASPPKCYEGSSSSDESVQD
APPPASPPKCDDGSSSSDESVQDAPPPASPPKQESDTTNWGLASFVNPVKRDSPGNSFPL
LVSAGGGGTPAANATNSAALPMGLFGGDEGPLSSAGFMTSSDSHGFDVNDILQPLDSSKE
LDPDHKDNYSATKINGLRMKISKKGQGGPEPTGCSSNSTSSSNKEVSKKSSVGKSPSTAS
RNSSKTATNRTPRKGADKKPAERPASASNAKAESSEKTKANSSKAGQTTPSNKTNWAEPS
PKADKTTKTVQGKKSSDKKGKRTPQTSSKVKSKEFIDSDSESDLEVDVVNISPEKGGASV
KASPSPRAKLNSSSKPKARDSGKKAAASSSGGGSQEKALSVDVLSSDNSLLSPLNEPLLS
PIEGDLASTVPKITYGNNGIPKSLIVSIDLSLLDRIPARKDSSRQGDSKKSSSSSESKPR
SKVQKRKRDNSQSQADAAGASTAEEVQTKRPKKEKEATSDSKATPTRSLPTPTRTLPIPA
TSLSTPTRNLPTPTRTPSQATPTRTTPTRTPPSSRQDTEKGRGSARRSSVSSTSSRLSEE
SAKTDRSAKRRKVERQTSQESSKKKEKKTKKTPKKQQVPSRCQDWDAPPAVVPEHSQNGV
ATEPVAKATNGHAAGSQWGELASGQHGGKAWERHDPRGDIPYFTSSKTDAEDRPLSADHY
LTEAKNLKHLADGLADKNQKTLTYVDAVLYFIQCGNAMESDPHLSESKSPSTMYLETVDL
IKFILRFNSHHMHNQSQDQTTSDKKLAVLCLRCQSLLYMKLFKLKKDYAMKYSKALTDHF
KNPPKNTQVPSPYQHNWNGARGTGTPSPMSPTPSPAGSVTSVGSQGSNNGDLTLNTPTQN
KLSNGTSGSSVTIPQRIHSLMQEHLKITNHLLHSQDLWEQANTLAQENPGEPRYVTHSHR
RTQVRTNHLLHSQDLWEQANTLAQENPEFFRRLDQRLGALTLHSTLIELVRYVRQGLQWL
KES
NT seq 5412 nt   +upstreamnt  +downstreamnt
atgcagaaatcacttactgaacatccaagtacaaatcttgtgttcgggaccagtggagtt
ttacagagtatcaggcccggcaaggcgtatgtggaaatgtccaccattgacgtggagact
gtacaagacgtagccgagagtatcgagtctcgcggcgggcggttcctggaagctcccgtc
atcggcacgaggaaacccgcggaggacggtatgctggtcatcgttgccgggggcgacaga
tcgctcttcgacgactgcgagtcctgcttcctggccatgggcaaaaaggccttctattta
ggagaggttgggagtggcacgaggatgaagctggtcgccaacatggttctgggaagtgtc
atggcggggtacgcggagggcatgtcgctggccgagagggcggggctcgatcttcagacg
gtcctcgacgtcttcaaggaggggcctctcaactgtgccgccgtcagatccaagggggat
gccatcctccacagcaggttcgagccttccttcccactgaagcatcagcagaaggacatg
cggttggcgctggctctcggagacgagctcaaacagtcgctacccgtggctgcagctgca
aacgagctggttgttttgttaaacgttgagaagtgttctgtttatagcgctgtcgttgtt
gtgagcggcagtgtggaccgcgtggagctccgtcgtcaggcacagctccagcgcgccggc
atgaaggtttccacggaaacccccgccgtgtccaagcctctcttcgacgcaccagtcaag
attgacccccctcccgacgaccacgtgtaccgtaagacccagaataattttccccatgtt
tgttccagattgacccccctcccgacgaccatttgtaccattgacccccctcccgatgac
catgtgtaccgtaagacccagaataattttccccatgtttgttccagattgaaccccctc
ctgacgaccttgtgtaccccagactcctcctcctctgcaagctcctccatcaagatggag
gcctcgtccacgaaggacgacgccttccagatgccggcgccgctctcgaccgcgcccggt
agccaccgcccgagccacagcggcgggaaggcgggcgacaggcccgaggagaggcccaac
ggtctgctcgccgccccgggccatggtggtaagaaggagggagtggagaaggaactgtcc
agggaagacgtgaagaggaagctgacgctcaccatgcccgacacttcagaggaagcaaga
ctgaactccagtgggggtctaaagagcgccggcaccgagaaggtggaaatcatcctcaag
gggagaaattgcgtgtatcatcctcaaagccgcgtacgtgcgccggttgtcgttggttac
cgccgtacgaggctggatgtttctcctgacgaggaccggatgctgttatcgccaggcgag
gtggttagaataacgctgctcgactttgcaggcgtctgtccgccgcgcaatgagaaccca
atcatcagttacgaggatttaattgcggatgaggtcccagcgctgggagcggaggcacag
gagatgactgaggtcggccctcctctgactgggatccacacgccaatcaagactgacgtc
tccaagtttcccttccctgcaaaccaggatgttcccagtgcgcagctgagccgcacaaag
agaaaaaccaccgcggagtccagtggcggcgggaagacgaaacccatggggccatcctcc
gaaccaaagtggggtattggatcgattatcccgcgagatcaatgggtccttgtgacggct
tgccacccgcaggcgtcgagatgggccggcggtaaagcacccgtccccgcttgtttgcgc
tgtgcatttattgctgtttgccgggtaaacacacttgtcggtggttccttcggacgtgag
ccgctgggattgtggggaagggataaagctggcagcagtgccgggggtgatttttcttcc
cggaggttcaccgggagttcagctccttggttgaagaaatactttctggacatgagcgac
agtgaagacgacgatgatcaggctcgacagaccaagaccgcaggaagaaatgctcagaaa
atgagtgttggtgctgtcttgtctttcaatgcccctgaggtgcttacagatcacagggat
cttccaggtcatatagggcgcttccagtctggtgacctcctgacagtcctgtccgcaaat
gaaagccgctgcccgtccgtcaaccggcggtccggtcggtcgtgtgagaaaaaatctggg
cacgtttctgtggtcggtatttaccacgggctgttaccagcgtggtcgggggatcccacg
tgtgatgaagggtcgtcctcgagcgatgagagcgttcaggacgccccgccgcccgcctcg
ccgcccaagtgtgatgaagggtcgtcctcgagcgatgagagcgttcaggacgccccgccg
cccgcctcgccgcccaagtgttatgaagggtcgtcctcgagcgatgagagcgttcaggac
gccccgccgcccgcctcgccgcccaagtgtgatgacgggtcgtcatcgagcgatgagagc
gttcaggacgccccgccgcccgcctcgccgcccaagcaggagagcgacaccaccaactgg
gggctggcttccttcgtcaaccccgtcaagagggactctcccggcaactccttccccctg
ctggtgtccgcgggcggcggaggaacgcccgcggcgaacgccacgaactccgcggcgctg
cccatgggattatttggcggtgacgagggtccgctgagctctgcgggattcatgacgtca
tcggacagccacgggtttgacgtcaacgacatcttgcaaccgctggattcctccaaggag
ttggatccggaccacaaggataactacagcgcgacgaaaattaacgggttgcgtatgaag
ataagcaagaagggccagggcggtcccgaaccgacgggttgtagtagtaacagtactagt
agtagcaacaaagaagtgtccaagaaatcttccgtgggaaagtcgccctccactgcaagt
cgcaattcttccaaaaccgccacaaacagaactccaagaaaaggcgcggacaaaaagcca
gcggagaggccggcctctgcatctaatgcgaaggcggaaagtagcgaaaagacgaaggct
aacagtagcaaagctggccagaccacccctagtaacaaaacgaactgggccgagcccagc
cctaaggcggacaagacaaccaagacggtgcagggaaagaagtccagtgacaagaaaggc
aaacggacgccacagacgagcagtaaggtcaagtcaaaggagtttatcgactccgacagc
gaatcagacttggaggttgacgtggtgaatatttctccggagaaggggggcgcgtcggtg
aaagcgagcccctccccccgggccaaactgaacagctccagcaaaccaaaggcgagggac
agcggcaagaaggccgcggcctcgagtagcggcggcggcagccaggaaaaagcgctgtct
gtggacgttttatccagcgataactcgttactgtcccccctaaacgaacctctcttgtct
cccattgagggggacctcgcttccactgtgccgaaaatcacctatggcaacaacggcatt
ccgaagtctttgatagttagcattgatctctccttactggacagaatacccgcccggaaa
gactcatccagacagggagatagcaaaaagtccagttcctcatcggagagcaaaccccgc
agtaaggtacagaagaggaaaagagacaactcccaatcccaggcggatgcggctggagca
agcacggcggaggaggttcaaacaaagaggccaaagaaagagaaggaggcgacgtcggat
tccaaagctacccccaccagaagtctccccacccccaccagaaccctccccatccccgcc
accagcctcagcacccccacacggaacctccccacccccaccaggaccccctcccaggcc
acccccacccgcaccactccaacaagaacccccccgagcagcaggcaggacactgagaaa
ggaagaggctcggcgcgtcgctccagtgtcagtagcacctccagcaggttaagcgaggag
agcgccaaaaccgaccgctccgcaaaacggcggaaagtcgagcgacaaacctcgcaagaa
tccagcaagaaaaaggaaaagaaaaccaagaagacacccaaaaaacaacaagtgccttcc
cgttgtcaggactgggacgcgcctccagccgtcgtccccgagcacagccagaacggcgtc
gccacggagcccgtcgccaaggcaacgaacgggcacgcggcggggagccagtggggggag
ctggcgtcgggtcagcatggcggaaaggcgtgggagagacacgacccccgaggggacatt
ccgtacttcaccagcagtaagacagacgcagaggacaggcctctgtcggcagaccactac
ttaacagaagccaaaaatctcaagcatctcgctgacggcttggcggacaagaaccagaag
acactaacgtacgtggatgcagtgttgtacttcatccagtgcggcaatgccatggagagc
gaccctcatctgtccgagtccaagtccccctcaaccatgtacttagagaccgtcgacctc
atcaagttcatcctgaggttcaacagtcaccacatgcacaaccagagtcaggaccagacc
acttcagacaagaaacttgcagtcctgtgcctgagatgtcagtcccttttgtacatgaag
ctcttcaagctgaagaaagactatgccatgaagtactccaaggcgctgactgaccacttc
aagaaccctcccaagaacacacaagtcccctcaccctaccagcacaactggaacggtgca
aggggcacagggaccccctcccccatgtcccccaccccctcccctgcaggcagtgttaca
tcggtggggtcccaaggcagcaacaacggagacctcaccctcaacacacccacacagaac
aaactgagtaacggcacgtcgggcagcagcgtgactattccgcagaggatccacagcctg
atgcaggagcacctcaagatcaccaaccacctgctgcacagccaggacctgtgggagcag
gccaacacactcgcacaggagaacccaggagaacccaggtacgtaacacactcgcacagg
agaacccaggtacgtaccaaccacctgctgcacagccaggacctgtgggagcaggccaac
acactcgcacaggagaacccagaatttttcagaagacttgaccagagattgggagcgctc
accctacacagtaccctgatcgagctggtgagatacgtccggcagggcctgcagtggctc
aaggagtcctga

DBGET integrated database retrieval system