KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_92996Help
Entry
BRAFLDRAFT_92996  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    BRAFLDRAFT_92996
Protein phosphatases and associated proteins [BR:bfo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     BRAFLDRAFT_92996
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 7241213
NCBI-ProteinID: XP_002610272
JGI: 92996
UniProt: C3Y0K9
AA seq 169 aa AA seqDB search
MGNESSLPEMCTHFDPEEIRRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDI
FDQDGNGEVDFKEFIEGMSQFSMKGDKNTKLRFAFKIYDMDKDGYISNGELFQVLKMMVG
SNLKDTQLQQIVDKTIINADKDGDGKISFEEFCEVVGSMDIHKKMVVEV
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggggaatgaatcgtcccttccagaaatgtgcacacattttgacccggaggaaatccgc
aggttagggaagcggtttaagaagctggacctggacaactcagggtccctgtcggtggag
gagttcatgtcgttaccagagctgcagcagaacccactggtccaacgggttattgacatt
ttcgaccaagacggcaatggagaggtggactttaaagaattcatagaaggaatgtcgcag
ttcagtatgaagggagataagaacaccaagctaagatttgcctttaagatttatgacatg
gacaaagacggctacatctccaacggggagctgttccaggtgctgaagatgatggtgggc
agcaacctgaaggacacacagctgcagcagatcgtcgacaaaaccatcatcaatgcagac
aaggacggcgacgggaagatttcttttgaagaattttgtgaagttgttggaagtatggat
atccacaagaagatggtggtggaggtgtaa

DBGET integrated database retrieval system