KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_93656Help
Entry
BRAFLDRAFT_93656  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo04068  FoxO signaling pathway
bfo04933  AGE-RAGE signaling pathway in diabetic complications
Module
bfo_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    BRAFLDRAFT_93656
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    BRAFLDRAFT_93656
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     BRAFLDRAFT_93656
Protein kinases [BR:bfo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   BRAFLDRAFT_93656
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH RIO1 Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 7245423
NCBI-ProteinID: XP_002613613
JGI: 93656
UniProt: C3XQP6
AA seq 349 aa AA seqDB search
MTEQPAEKIKPHFYRVELNRTIWEIPERYQMLTPIGSGAYGQVCSAFDQQLQHKVAIKKL
ARPFQSEIHAKRSYRELRLLKHMEHENVIGLLNVMTPTLTFEDFQDVYLVTPLMGADLNN
IVKCQKLTDDHVQFLVYQVLRGLKYIHSAGIIHRDLKPSNIAVNEDCELKILDFGLARLA
DDAMTGYVATRWYRAPEIMLNWMHYNKTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKRI
MELVGTPDQEFLQKISSESARSYVESLPKQSKKDFRGYFCGANPDAVDLLDKMLILDTDK
RLTAEQALEHPYMRQYHDPTDEPTAAAYDDSFEKMELGVAEWRSKLIYH
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacagccggcagaaaagatcaaaccgcacttttatcgtgtggagctgaaccgg
acgatatgggagatccccgagcgctatcagatgctgactccgatcggctcaggggcgtac
ggacaggtttgctcagcatttgatcagcagttgcagcacaaggtggcgataaagaagctt
gccagaccattccagtccgagattcatgccaaacggagctaccgcgagctcaggctgctc
aaacacatggaacacgaaaatgtgattggactgttgaatgttatgacccctactctgacc
ttcgaggatttccaggatgtgtacctcgtgacgcccctgatgggtgcagacctgaacaac
atcgtgaagtgtcagaagctgacagatgaccatgtacagttccttgtctatcaagtgctc
agaggactcaagtatattcactccgctgggatcatccacagagatttgaagcccagtaac
attgctgttaacgaggactgtgagttaaagattctggatttcggtctggccaggctggca
gacgacgccatgacaggttacgttgcaacgagatggtacagagcgccggaaatcatgctg
aactggatgcactacaacaaaacagttgacatctggtctgtgggctgcatcatggctgag
ctgctgacggggagaaccctcttcccaggaaccgatcacattgatcagttgaagagaatc
atggagttggtgggaacacccgatcaagaattcctgcaaaaaatcagctcagagtctgcg
cgaagctacgtggagtctctccccaagcagtcgaagaaggacttccgtgggtacttctgc
ggagcgaatccggacgcggttgacctgttagacaagatgctgatcctggacacagacaag
cggctgacagcagagcaggccctggagcacccgtacatgcggcagtaccacgaccccacc
gacgagcccaccgcggccgcgtacgacgattcctttgagaagatggaactgggcgttgct
gagtggagaagtaagttgatatatcactag

DBGET integrated database retrieval system