KEGG   Bacteroides fragilis YCH46: BF1339
Entry
BF1339            CDS       T00202                                 

Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
bfr00620  Pyruvate metabolism
bfr00640  Propanoate metabolism
bfr00650  Butanoate metabolism
bfr01100  Metabolic pathways
bfr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BF1339
   00640 Propanoate metabolism
    BF1339
   00650 Butanoate metabolism
    BF1339
Enzymes [BR:bfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     BF1339
SSDB
Motif
Pfam: PFL-like Gly_radical Coatomer_WDAD SAF
Other DBs
NCBI-ProteinID: BAD48088
UniProt: Q64WN8
Position
complement(1582351..1584579)
AA seq 742 aa
MELNKTFKDGLWSKEINVRDFVSNNITPYEGDASFLQGPTERTKAVWNHCLKALEEERNN
NGIRALDYTTVSTITSHPAGYIDKENELIVGLQTDQVLKRAIKPFGGINVVMKACRENGV
EVDDRVKDIFTHYRKTHNDGVFDVYTEEIRSFRSLGFLTGLPDNYARGRIIGDYRRLALY
GLDRLIEAKKEDLHNLTGPMTEARIRLREEVAEQIKALKEIKVLGEYYGLDLSRPAYTAQ
EAVQWVYMAYLAAVKEQDGAAMSLGNVSSFLDIYLEYELSQGTITETFAQELIDQFVIKL
RMVRHLRMQSYNDIFAGDPTWVTESIGGRFNDGRTKVTKTSFRFLQTLYNLGPSPEPNMT
VLWSPELPEGFKAFCAQVSIDTSSVQYENDDLMREVRQSDDYGIACCVSYQEIGKQIQFF
GARANLAKALLLAINGGRCENTGTVMVKDIPVLTGETLKFEEVMANYKKVLIQIARVYNE
AMNIIHYMHDKYYYEKAQMAFVDTDPRINLAYGVAGLSIAIDSLSAIKYAHVKARRNDIG
LTEGFDIEGAFPCFGNDDDRVDHLGVDLVYFFSEELKKLPVYKNARPTLSLLTITSNVMY
GKKTGATPDGRAKGIAFAPGANPMHGRDKNGAIASLSSVAKLRYRDSQDGISNTFSIVPK
SLGATQEDRIDNLVTMMDGYFTKGAHHLNVNVLNREMLQDAMEHPEKYPQLTIRVSGYAV
NFVKLSREHQLEVISRSFHERM
NT seq 2229 nt   +upstreamnt  +downstreamnt
atggaactgaataagacctttaaagatggactttggagcaaagaaatcaatgtaagggat
ttcgttagtaacaacatcactccttatgaaggggatgcttctttcctgcaaggacctacc
gaacgcaccaaagctgtctggaatcactgtctcaaagctctcgaagaagagagaaacaat
aatggtattcgtgcactcgactacacaactgtatctactataacctctcaccctgccggc
tacatcgataaagaaaacgaactgatcgtcggactacagaccgatcaggtgttaaaacgt
gccatcaaaccgtttggcggaatcaatgtggttatgaaagcttgccgtgaaaacggagtg
gaagtagatgacagagttaaggatatcttcactcactatcgcaagactcataatgatggg
gtattcgatgtgtataccgaagaaattcgttcgttccgttcattgggattccttaccgga
cttcccgacaactatgcacgcggacgtatcatcggtgattatcgccgcctggctctctat
ggtcttgaccgcctgatagaagctaaaaaagaagatctgcataatctgacaggtcctatg
actgaagcccgcattcgtcttcgcgaagaagtagccgagcaaatcaaggccctgaaagag
attaaagtattgggcgaatattatggtttggatctgagccgaccggcatataccgcacag
gaagctgtacaatgggtgtatatggcttatctggctgccgtaaaagagcaggatggtgct
gccatgtcactgggtaatgtatcttcattcctcgacatctatcttgaatatgaattaagc
cagggtacgataaccgaaacattcgctcaggaactgatcgaccaattcgttatcaaactc
cgtatggtacgccacttgcgtatgcagtcgtacaacgatatttttgcgggtgatcccaca
tgggtgaccgaatctatcggtggacgtttcaatgatggacgtaccaaagttactaaaact
tctttccgcttcttgcagacactttataacttaggcccgtcaccggaacctaacatgact
gtactatggagccctgagttacccgaaggtttcaaagcattctgtgcacaagtatctatc
gacacttcttccgtacaatacgaaaacgacgacctaatgcgtgaagtccgtcaatcggat
gactacggaatcgcttgttgtgtttcatatcaggaaatcggaaagcagattcaattcttc
ggcgcacgtgccaaccttgccaaagccctgctactggctatcaacggaggacgttgcgaa
aatacaggtacagttatggtaaaagacatccctgtattgaccggtgaaacactgaagttc
gaagaagtaatggccaactataagaaagtattgatacaaattgcacgtgtatacaacgaa
gcaatgaatatcatacattacatgcacgataagtattactacgaaaaggcgcagatggct
ttcgtggatactgatccccgcattaacctcgcttatggtgtagccggactctcaatcgcc
atcgattcactgtccgccatcaaatatgcacatgtgaaagcccgtcgcaacgacatcgga
ctgacggagggattcgatatcgaaggtgctttcccttgtttcggtaatgacgatgaccgt
gtagaccacctgggtgtggacctggtatatttctttagcgaagaattaaagaaactcccc
gtatataagaatgcccgtcctaccctttcgctgctgactatcacttcgaacgtaatgtat
ggcaagaagaccggtgccactcctgacggacgcgccaaaggcattgcctttgctcccggt
gccaaccccatgcacggacgtgataaaaatggtgcaatcgcctcactgagttctgtagcc
aagttgcgttatcgcgactcacaggatggtatcagcaatacattctcaatcgttcccaaa
tcattgggagcaacacaagaagaccgtatcgacaatctggtgaccatgatggacggatat
tttacaaaaggcgcacaccacctgaacgtaaacgtgctgaaccgggaaatgttgcaggat
gcgatggaacatcccgaaaagtatccgcaactgactatccgtgtctcaggatatgccgtt
aatttcgtgaaattgagccgcgaacatcagttggaagtaatcagccgcagtttccacgaa
agaatgtaa

DBGET integrated database retrieval system