KEGG   Bacteroides fragilis YCH46: BF1487Help
Entry
BF1487            CDS       T00202                                 

Definition
(RefSeq) histidine decarboxylase
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
bfr00340  Histidine metabolism
bfr01100  Metabolic pathways
bfr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BF1487
Enzymes [BR:bfr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     BF1487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HDC DUF562
Motif
Other DBs
NCBI-GeneID: 3082250
NCBI-ProteinID: YP_098772
UniProt: Q64W88
Position
1733103..1733999
Genome map
AA seq 298 aa AA seqDB search
MKDLVSGIRYDASNVISQAIGPSKEFCMGYLNPGVVGGEGYISTMKLSVGTVDVKDLDAI
TERIVAKDRCEKNDAYLGQVNLMKASSFCGQNGAIWGFDLAMHDDIAKRKEMPIYMQAQP
EGADIPVYNIRPLLEATERLFGRAKERRFPVLPGAYVPGGSRKVVACGPVWVWSVIGLAI
LKDRSKGACLFVKDAGTYGDDSTTEGEAIGFLEGILRKATNSIALCGEDQDVIYDRIYIG
YKYTFVEPGQVGCALSCTPAVYMAQNAIPADMKPADLCQMTISDWEEKLGLEELTIFE
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatcttgtgtccggcatccggtatgatgcctctaatgtgattagtcaggctata
gggccaagtaaagaattttgcatgggatatttaaatcccggcgttgtgggtggtgaagga
tatatttcgactatgaaattgtcagtcggcacagttgacgtgaaagacctcgatgcaata
accgaaaggattgtagcgaaggatcgttgtgagaagaacgatgcgtatctcgggcaagtc
aacctgatgaaagcctcgtctttttgcggacagaatggagccatctggggatttgacctg
gcgatgcacgatgacattgccaaaaggaaagagatgcctatctacatgcaggcgcaaccc
gaaggagcggatatccctgtttataatatccgtccgttgctggaggcaaccgaacgtctg
ttcggccgtgccaaagagcgccgtttccctgtacttccgggagcttacgtaccgggaggt
agcagaaaagttgtggcatgcggtcctgtatgggtatggtctgtaatcggcctggccatt
ctgaaagaccgtagtaaaggagcttgcctgtttgtaaaggatgcaggtacttatggagac
gattcgacaacagaaggtgaagccatcggttttctggaaggtatactccgtaaagcgacc
aacagtattgccctttgcggtgaagatcaggatgtgatctacgaccgtatttacatcggt
tataaatatacatttgtagaacccggtcaggtaggttgtgccctgtcgtgcactcctgcc
gtttatatggcgcaaaatgctattcctgccgatatgaaaccggccgatctttgccagatg
actatcagtgactgggaagagaagctaggtctggaagagttgacaatcttcgaatag

DBGET integrated database retrieval system