KEGG   Bacteroides fragilis YCH46: BF1854Help
Entry
BF1854            CDS       T00202                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
bfr00030  Pentose phosphate pathway
bfr00480  Glutathione metabolism
bfr01100  Metabolic pathways
bfr01110  Biosynthesis of secondary metabolites
bfr01120  Microbial metabolism in diverse environments
bfr01130  Biosynthesis of antibiotics
bfr01200  Carbon metabolism
Module
bfr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bfr_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BF1854
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BF1854
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bfr04147]
    BF1854
Enzymes [BR:bfr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BF1854
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BF1854
Exosome [BR:bfr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BF1854
  Exosomal proteins of colorectal cancer cells
   BF1854
  Exosomal proteins of bladder cancer cells
   BF1854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N Citrate_synt
Motif
Other DBs
NCBI-GeneID: 3084465
NCBI-ProteinID: YP_099136
UniProt: Q64V76
Position
2181632..2183128
Genome map
AA seq 498 aa AA seqDB search
MSKFVMTIFGASGDLTKRKLMPALYSLYVAKRLPEEFEILGVGRTVYEDADYRTYIYNEM
EKFVKSEEQNKEKMDAFVGHLHYLAIDPALESGYGQLRLRIEELSGDSRPDDLLFYLATP
PSLYGVIPLHLKSVHLNKGRARIIVEKPFGYDLESAEKLNKIYASVFDEHQIYRIDHFLG
KETAQNLLAFRFANGIFEPLWNRNYIDYVEVTAVENLGIEQRGGFYDTTGALRDMVQNHL
IQLVALTAMEPPAVFNADNFRNEVVKVYESLTPLTETDLSEHIVRGQYTAGGNKRGYREE
KNISPDSRTETYIAMKLGISNWRWSGVPFYIRTGKQMPTKVTEIVVHFRETPHQMFHCAG
GNCPRANKLILRLQPNEGIVLKFGMKVPGPGFEVKQVTMDFSYDQLGGVPGGDAYARLIE
DCILGDQTLFTRSDAVEASWHFFDPILRYWNEHPEAPLYGYPAGTWGPLESEAMMHEHGA
EWTNPCKNLTNTDQYCEL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatttgtaatgactatctttggtgcttcgggtgacttgacgaagcgtaagttg
atgccggcattgtattcgttgtatgtagccaagcgtcttccggaagaatttgaaattctc
ggggtgggacgtacggtttatgaagatgcggactatcggacttacatttataatgagatg
gagaaatttgtgaagtcggaagagcagaataaggagaagatggacgctttcgttggacat
cttcactatctggcaatagacccggcattggaaagcggatacggacagcttcgcctgcgc
attgaagaactgagcggagatagccggccggatgacctgctgttttacctcgctacgcct
ccatcattgtatggtgtgattccgttgcacctgaagtcggtgcatctgaataaaggccgt
gcacgaattatcgttgaaaagccattcgggtatgatctggaatcggctgagaaactgaat
aaaatttatgcttctgtattcgacgaacatcagatttaccgaatcgatcatttcttaggt
aaagaaacggctcagaacctgttagcttttcgttttgccaatggtatttttgagccttta
tggaaccgtaattatatagattatgtggaagtgaccgccgtggagaatctcggaatcgag
caacgcggcggtttttatgatactacgggtgcactgagggatatggtacagaatcatctg
atccagctcgtggcattgactgctatggaacctcccgctgtgtttaatgcggataatttc
cgtaatgaagtggtgaaggtatacgagtctctgactcctttgaccgaaacggatttgagt
gaacatattgtccgggggcaatatacggcagggggaaataaaagggggtatcgggaagag
aagaatatttcacccgactcacgtaccgagacttatattgcaatgaaactgggtatcagt
aactggcggtggagtggagtacctttttatatcaggaccggaaaacagatgccgacaaaa
gtgactgagatagtggtgcatttccgtgaaactcctcatcagatgttccattgcgcgggt
ggtaattgtccgagagccaataagctgatattgcgtttgcagcccaatgaaggtattgtg
ttgaaatttggcatgaaagtgccgggacccggatttgaggtcaaacaggtaacgatggat
ttcagttatgatcagttggggggcgtccccggcggagatgcctatgcccgtctgatagaa
gactgtatcctgggcgaccagaccctctttacacggagtgatgcagtagaagcatcctgg
catttcttcgatccgattctgcgttattggaatgaacatcccgaggcgccgttgtatggt
tatcctgctggaacttggggacctttggagagtgaggctatgatgcatgagcatggtgcc
gaatggaccaatccatgcaagaacttaacaaacacagatcaatattgcgagctatga

DBGET integrated database retrieval system