KEGG   Bacteroides fragilis YCH46: BF1894
Entry
BF1894            CDS       T00202                                 

Name
(GenBank) outer membrane protein Omp121
  KO
K02014  iron complex outermembrane recepter protein
Organism
bfr  Bacteroides fragilis YCH46
Brite
KEGG Orthology (KO) [BR:bfr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bfr02000]
    BF1894
Transporters [BR:bfr02000]
 Other transporters
  Pores ion channels [TC:1]
   BF1894
SSDB
Motif
Pfam: TonB_dep_Rec Plug CarbopepD_reg_2 CarboxypepD_reg OMP_b-brl_3
Other DBs
NCBI-ProteinID: BAD48642
UniProt: Q64V36
Position
2226956..2230333
AA seq 1125 aa
MNNSKIINVRLMKKVLVLVLSFLSVTAFAQNITVKGIVKDGTGEPIIGGSVLVKGSSIGT
VTDVDGNYTLSNVPADGVLEFSYIGMKKQDVKVSGKTVINVVLQEDTQILDEVVVTALGL
KREQKALGYAVTEVKGDDLKAANTISPVAALQGKVAGVEIRQSDGGMFGATKIQIRGAST
LKGNNQPIYVIDGVILDNSTSGNTTMDWDAGNNNANDYGNELKNLNPDDFETVSVLKGAA
ATALYGSRGLNGAVVITTKSGKGFKGFGVSVSQTFGIDHAYRTPDIQTEYGVGLMPGWKD
TDNNGSVWDPFQFKLDDKGDRTLIGAGSYGWGPKYDGQPIRNYDGTWTNYSPHKNNMLDL
YQLGLNSNTNVAIRGGNDKTSYYTSLSYKKARSTSEKNTFERYSFLLKGSHKISDRVEVS
AAMSFTNSNPKNSPRTVGERFVNPNGTIMTPMLDVNYFRDKYLGEHGGLASTSYGDKYGS
VPGRDLFFMIDKYDYSQKETVVRPQMEVNVQILDWLRFKADANMNYYYTKFEEKQLGSGY
ANEGGKYTMGQTTKEQATFGGTFTVNKQIQDFSVGGFARYEYYTSRSEAYKVYTDGGMVV
PGQWFVDNSKNPKKSEASISNTKRMMSAVFALNLGWKNQVYLDVTGRNDWSSSLVYQNGM
GTYSYFYPSVSGSWLLNETFDLPHWITFAKVRGSWAQVGNDTDPYYVNSVYGFETKEMYD
GNIYVNTLDKTMKSLKLKPERKNAWEVGLDLRLFDSRLNFDFTYYKENTRDQIMSIEVPA
ISGVNTQLINAGNIQNKGIEIAVNATPYKNKDWQWDVAMTYTKNKNTIISLHENVADYIA
LSGYANDYDYHIGSVAKVGGDYGLLMSDILPAKNEKGETLLEWDDSWRGAYEARSGKVQE
VGKMTPDFLGSLSTTLSWKNLSLHIATDMRFGGLVASYSNLYGTQAGWIKSSLKWRDPEH
GGLSWTSQYGDSKGISYGDGVIPDGVFKNGTFATLVDGTKMDVSGMSYKQLVAEGKLEPT
HAGTYHVNRAAWGQNTIFDTWVHELNYIALREITLSYRFPKSVASKFGAQGLGLSFSARN
LGYLYNSLPNHLNPESVRGNTASEFRIRGYEPYTANYMMTINVDF
NT seq 3378 nt   +upstreamnt  +downstreamnt
atgaataactcgaaaattatcaatgtgagattgatgaaaaaggtgttagtgcttgttcta
tcttttttgtctgttactgcttttgcgcagaatataacagtgaaaggaattgtaaaagat
gggaccggtgaaccgattatcggagggagtgtacttgttaaaggttcatcgatcggtaca
gtgacagatgttgatggcaattacactttatctaatgttcctgcagacggagttctggag
ttttcttacatcggcatgaagaaacaggatgtaaaagtaagcggtaaaactgttattaat
gttgtgcttcaagaagatacccagatactggacgaagtagtggtgacagccttagggttg
aagcgtgaacagaaagctttggggtatgcagtgaccgaggtcaaaggcgatgacctgaaa
gctgccaatacgatttctccggtagccgccttacaaggaaaagtagcgggtgtcgagatc
cgtcagtcagacggaggtatgttcggagcgacgaagattcagattcgtggtgcttctact
ttgaaaggaaacaatcagccgatttatgtgatcgacggagttattctcgataactcgact
tcgggaaataccacaatggactgggatgccggaaacaataatgccaatgactatggtaat
gaactgaagaacctcaatccggatgactttgagacagtttcggtcctgaaaggtgctgct
gcgactgccctttacggttcacgtggtctgaacggagctgtggtgattaccaccaaatcg
ggaaaaggcttcaaaggcttcggagtttctgtatcacaaacatttggtatcgatcatgct
taccggacaccggatatccagactgaatatggggtggggttgatgcctggctggaaagac
acggacaacaatggttctgtatgggatccttttcagttcaaactcgatgataaaggagac
cggacactaataggcgcaggcagttatggatggggacctaaatacgatggtcagccgatc
cgcaactatgatggtacctggaccaattattcgccccataaaaacaacatgctggatttg
tatcaattggggctgaactccaatacgaatgtggctattcgcggtggcaatgataaaaca
tcgtattacacttctctttcttataagaaagcaagatctaccagcgaaaagaatacattt
gagcgttattcgtttttattgaaaggttcgcataaaatcagtgatcgggtggaagtttcg
gctgctatgagtttcaccaactcaaatccgaagaattctccgcgaacagtaggagagcgt
tttgtcaatccgaacggaaccattatgactccgatgctggatgtgaattatttccgcgat
aaatatctgggtgagcatggtggactggcatctacaagttatggtgacaagtatggttca
gttccgggacgtgatttgttttttatgatcgataaatacgattattcccagaaagagact
gtggttcgtccccaaatggaagtgaatgtgcagattctggattggctgagatttaaagcc
gatgccaatatgaattactattacactaagtttgaagaaaaacaactgggtagtggatat
gcaaatgaaggcggtaagtatactatggggcaaaccacaaaagagcaggctacctttggc
ggaacatttactgtcaataagcagatacaagattttagcgtaggtggtttcgcacgatat
gaatactatacaagtcgttcggaagcatataaagtatatacagatggcggtatggtagta
ccgggacaatggtttgtcgacaactcaaagaaccctaaaaagtcggaagcgagcatttca
aatacaaagagaatgatgtctgctgtctttgctttgaatctgggatggaaaaatcaggtt
tatttagatgtaacaggacgtaatgactggtcgtcttctttggtatatcaaaacgggatg
ggtacatattcttacttctacccgtcagtatccggttcatggctgctcaatgaaacattc
gatttgccgcattggattacatttgctaaagtacgcggatcgtgggcacaggtcggtaac
gataccgatccctattatgtgaactcggtatatggctttgaaactaaagaaatgtatgat
ggcaatatctatgtgaacactctcgataagacaatgaagagtttgaagctgaaaccggag
cgtaagaatgcctgggaagttggtttggatttacgtttgtttgacagccgtttgaacttt
gactttacttattataaagaaaatacgagagaccagatcatgtcgattgaggttcctgct
atttcgggtgtgaacactcagttgataaatgctggtaatattcagaataaaggtattgaa
attgctgtaaacgccactccgtacaaaaataaagactggcagtgggatgtcgcaatgaca
tatacaaagaataaaaatactattatctcattacatgaaaatgtagcagactacatcgca
ttgagcggctatgctaatgattacgattaccatatcggttcggttgccaaagtaggtggt
gactacggattattgatgtccgacattcttccggctaaaaatgaaaaaggagaaacattg
ttggagtgggacgacagttggcggggagcttacgaagcacgtagcggaaaagtacaggaa
gtgggtaaaatgactcccgactttttaggctctttatctactactctgtcttggaaaaat
ttgagcctgcatattgctactgacatgcgttttggaggattggtagcttcttactctaac
ttgtatggtacacaggccggatggatcaagagttctttaaaatggcgtgatcccgaacat
ggtggtttgtcttggaccagccagtacggtgacagtaaaggaatctcttatggcgatggt
gttatccccgacggagtatttaagaatggtacgttcgcaacacttgtagacggaacgaaa
atggatgtaagcggtatgtcctacaaacagttggtggcagaagggaaactggaacccaca
catgccggaacttatcatgtaaaccgtgcggcctggggacagaatacgatattcgacact
tgggtacacgagttgaactatattgctttgcgcgagatcaccttatcgtatcgcttcccg
aaatcagtggcaagtaagtttggtgctcagggattgggattgagcttctctgcacgtaat
ctgggatatctgtataactcgttgcctaaccatctgaatcctgagagtgttcgtggtaat
acggcttctgagttccgtatccgtggctatgaaccttacacagctaattatatgatgact
attaatgtagatttctaa

DBGET integrated database retrieval system