KEGG   Bacteroides fragilis YCH46: BF1956
Entry
BF1956            CDS       T00202                                 

Definition
(GenBank) hypothetical protein
Organism
bfr  Bacteroides fragilis YCH46
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: BAD48704
UniProt: Q64UX5
Position
complement(2298692..2299141)
AA seq 149 aa
MAILEYGIGGNEVKVDTSEAIANIPENRSLIVEQLTADEPITPEAVKGLSTIEEVFAHFL
PNIDVEFENEEGQPVKENFRFSSVADFSVKNMTQNSPFLHKLDTEKTFYEGMVTQLRSNK
VLQRVLENPESKKAFISALEALSNELKTE
NT seq 450 nt   +upstreamnt  +downstreamnt
atggcaatacttgaatatggaattggtggtaatgaagtgaaagttgatacttccgaagcc
atcgcaaacattccggagaatcgctccctcatagttgaacagttaactgctgacgaacct
ataactcctgaagcggtcaaaggcttaagcactatcgaagaggtgtttgcgcacttcttg
cccaacattgatgttgaatttgaaaatgaagaagggcaaccggtaaaagaaaactttaga
tttagctcagtggcggacttcagtgtgaagaatatgacacagaatagtccattcctccat
aagttggatacggagaaaacattctacgaggggatggtgacacaattgcgttctaataaa
gttctacaacgagtgttggagaatccggaatccaaaaaggcgtttatcagcgcactggag
gcattgagtaacgaattaaagaccgaataa

DBGET integrated database retrieval system