KEGG   Bacteroides fragilis YCH46: BF2527Help
Entry
BF2527            CDS       T00202                                 

Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bfr  Bacteroides fragilis YCH46
Brite
Enzymes [BR:bfr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BF2527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 3083785
NCBI-ProteinID: YP_099810
UniProt: P53638
Position
2908703..2909320
Genome map
AA seq 205 aa AA seqDB search
MNTLLMSLIFTTMTYEMPKLPYANNALEPVISQQTIDYHYGKHLQTYVNNLNSLVPGTEY
EGKTVEAIVASAPDGAIFNNAGQVLNHTLYFLQFAPKPAKNEPAGKLGEAIKRDFGSFEN
FKKEFNAASVGLFGSGWAWLSVDKDGKLHITKEPNGSNPVRAGLKPLLGFDVWEHAYYLD
YQNRRADHVNKLWEIIDWDVVEKRL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaatacattattaatgtctttaatatttacgaccatgacttacgaaatgcctaaactt
ccgtacgcaaacaatgcgctggaacctgtaatcagtcagcaaaccatcgattaccattat
ggtaaacatcttcaaacatatgtaaacaatctcaatagcctggttccgggcaccgaatat
gaaggaaaaacagtagaagccatcgtagcctcggctcccgacggagctatcttcaataat
gccggacaggtgctgaaccatactctgtacttcctgcaatttgcgccgaaaccggcaaag
aacgaaccggcaggcaagttgggagaagccatcaaacgcgacttcggcagctttgaaaac
ttcaagaaagagttcaacgcagcttctgtaggattgttcggttcgggatgggcctggctg
tctgttgacaaagacggaaagctgcacatcaccaaagagcccaacggaagcaatccggta
cgcgcgggactgaaaccgttactgggatttgacgtatgggaacatgcttactacctcgac
tatcagaaccgtcgtgccgaccacgtaaacaaactgtgggagatcatcgactgggatgtc
gtagaaaaacggctgtaa

DBGET integrated database retrieval system