KEGG   Bacteroides fragilis YCH46: BF2836Help
Entry
BF2836            CDS       T00202                                 

Definition
(RefSeq) hypothetical protein
Organism
bfr  Bacteroides fragilis YCH46
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 3083489
NCBI-ProteinID: YP_100120
UniProt: Q64SE4
Position
3245043..3245978
Genome map
AA seq 311 aa AA seqDB search
MGTMLAQKKPLESIQRSQAINFVAEIFYDELQFILDRRLLDHTMVNCHGMNSRVKSRDVL
SVSVQHIAATNADKEYILLNLARNSIYHQLPELLFHPLVLSTPGMSNKEIVEAIRANEKQ
DKELIQFFAPFDTEFFKEKVRINNRHLNFFSDPDSKKNFIKMIEVMENVELSITSHQKYK
LFLFLCNAERYKENLPAIEQLLLIVLGLKVKLRLEVHEIDETVYLSVGSGCVGQTLGLNG
LMISETDDLTATIILDTPTDDYEEVKTHLSNVRRILEFFILSTRNIEVDYLVRGETDFIL
GENRLGYNMNL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgggaacaatgttagcgcaaaagaaacccttggaaagcatccaacgaagtcaggcaata
aattttgtcgcagaaatcttttatgatgaacttcaatttattcttgaccggcggctgttg
gaccatactatggttaattgccatggtatgaacagtcgtgtgaaatccagagatgtatta
agtgtttcggtacagcatatcgcggcgacaaatgccgacaaagaatatatattgctgaat
ctggcaagaaacagcatctatcatcaattgccggaattactatttcatccattggtgctt
agcacaccgggcatgagcaacaaggagatagttgaagccatccgagccaatgaaaaacag
gataaagagcttatacaattctttgcaccctttgatacagagtttttcaaagaaaaggtc
cgtatcaataaccgccatctgaatttcttttcagacccggactccaagaagaacttcatc
aagatgattgaagtaatggaaaatgtcgaactatccattacttcccatcagaaatataag
ctgttcctattcctctgcaatgcagaacggtataaagagaacctgcctgctatcgagcaa
ctgcttcttatcgttttgggattgaaggtgaaactgcgactggaagtccatgagattgat
gaaacggtttacctttccgtcggttccggatgtgtcggacagacattaggccttaatggt
ctaatgataagcgaaaccgatgatttgacggcgacaatcatccttgatactccgacagat
gactatgaggaggtaaaaacgcatctatccaatgtccgccggatacttgaatttttcatc
ctttcaacaagaaatatcgaagttgattatctggtacgtggagaaacggattttatactc
ggagaaaaccgattaggatataatatgaacttatga

DBGET integrated database retrieval system