KEGG   Bacteroides fragilis YCH46: BF3252Help
Entry
BF3252            CDS       T00202                                 

Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
bfr00010  Glycolysis / Gluconeogenesis
bfr00260  Glycine, serine and threonine metabolism
bfr00680  Methane metabolism
bfr01100  Metabolic pathways
bfr01110  Biosynthesis of secondary metabolites
bfr01120  Microbial metabolism in diverse environments
bfr01130  Biosynthesis of antibiotics
bfr01200  Carbon metabolism
bfr01230  Biosynthesis of amino acids
Module
bfr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bfr_M00002  Glycolysis, core module involving three-carbon compounds
bfr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF3252
  Energy metabolism
   00680 Methane metabolism
    BF3252
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BF3252
Enzymes [BR:bfr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BF3252
Membrane trafficking [BR:bfr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BF3252
Exosome [BR:bfr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BF3252
  Exosomal proteins of melanoma cells
   BF3252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 3082051
NCBI-ProteinID: YP_100530
UniProt: Q64R85
Position
complement(3695104..3695850)
Genome map
AA seq 248 aa AA seqDB search
MKKIVLLRHGESAWNKENRFTGWTDVDLTEKGIAEACKAGELLKENGFNFDKAYTSYLKR
AVKTLNCVLDRMDQDWIPVEKSWRLNEKHYGDLQGLNKSETAAKYGDEQVLIWRRSYDIA
PNALSEDDPRNPRFENRYQEVPDAELPRTESLKDTIERIMPYWKCIIFPNLKTADEILVV
AHGNSLRGIIKHLKHISDEEIVKLNLPTAVPYVFEFSDELNLEKDYFLGDPEEIRKLMEA
VANQGKKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattgtattgctccgtcatggagaaagtgcatggaacaaagagaaccgtttt
accggttggacagatgtcgatctgacagaaaaaggaattgccgaagcctgtaaagcaggc
gaactactgaaagagaatggatttaacttcgataaagcttatacgtcataccttaaacga
gcggtgaaaacgctgaattgcgtactcgaccggatggatcaggactggattccggtagag
aaaagctggcgcctgaatgaaaaacattacggcgatctgcaaggactgaacaaaagcgaa
acagccgctaaatacggggatgaacaggtgcttatctggcgcaggagttatgatatagct
cccaatgccctgtcggaagacgatccgagaaatccccgctttgagaatcgttatcaggaa
gtacccgatgcggaacttcctcggacagaatctctgaaagatactatcgaacgtatcatg
ccttattggaagtgtatcatcttcccgaatctgaaaacggctgatgaaattctggttgtt
gcccacggaaatagtttgcgcggcatcatcaagcacttgaagcacatctccgatgaagag
atcgtaaaactgaatctgccgactgccgtcccttacgtatttgagttcagtgacgaactg
aatctggaaaaagactatttcctgggtgatcccgaagaaatccgtaagttgatggaagcg
gttgccaaccagggaaagaaaaaataa

DBGET integrated database retrieval system