KEGG   Bacteroides fragilis YCH46: BF3956Help
Entry
BF3956            CDS       T00202                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
bfr00010  Glycolysis / Gluconeogenesis
bfr00051  Fructose and mannose metabolism
bfr00562  Inositol phosphate metabolism
bfr01100  Metabolic pathways
bfr01110  Biosynthesis of secondary metabolites
bfr01120  Microbial metabolism in diverse environments
bfr01130  Biosynthesis of antibiotics
bfr01200  Carbon metabolism
bfr01230  Biosynthesis of amino acids
Module
bfr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bfr_M00002  Glycolysis, core module involving three-carbon compounds
bfr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF3956
   00051 Fructose and mannose metabolism
    BF3956
   00562 Inositol phosphate metabolism
    BF3956
Enzymes [BR:bfr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BF3956
Exosome [BR:bfr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BF3956
  Exosomal proteins of bladder cancer cells
   BF3956
  Exosomal proteins of melanoma cells
   BF3956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 3085037
NCBI-ProteinID: YP_101232
UniProt: Q64P83
Position
complement(4511582..4512337)
Genome map
AA seq 251 aa AA seqDB search
MRKNIVAGNWKMNKTLQEGIALAKELNEALANEKPNCDVIICTPFIHLASVTPLVDAAKI
GVGAENCADKESGAYTGEVSAAMVASTGAKYVILGHSERRAYYGETVEILKDKVKLALAN
GLTPIFCIGEVLEEREANKQNEVVAAQLASVFDLSAEDFSKIVLAYEPVWAIGTGKTASP
AQAQEIHAFIRSAVAEKYGKEIADNTSILYGGSCKPSNAKELFANPDVDGGLIGGAALKV
ADFKGIIDAFN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagaacattgttgcaggaaactggaaaatgaacaaaacccttcaggagggtatt
gctcttgcaaaagaactgaatgaagctttggctaacgaaaagcctaactgtgatgtcatt
atctgtactccgtttattcaccttgcttctgttactcccttggtagatgcagctaagatc
ggtgtaggtgctgagaactgtgctgacaaagaatccggagcttatacaggtgaagtatcg
gctgctatggtagcttctaccggtgctaaatacgttattctgggtcactcggaacgtcgt
gcttactatggtgaaacggttgagatcctgaaggacaaagtgaaactggctttggcaaat
ggtctgactccgattttctgtatcggtgaggttctggaagaacgcgaggctaacaaacag
aacgaggttgttgctgctcagttggcatctgtattcgatctttcggcggaagatttctct
aagatcgttctggcttacgaaccggtttgggctatcggtaccggtaaaacagcttctcct
gctcaggctcaggaaatccatgcgttcatccgttcggctgttgctgagaaatacggaaaa
gaaatcgctgacaacacttcaatcctttatggtggtagctgcaaaccttctaatgctaaa
gaactgtttgctaaccctgatgttgacggtggtctgatcggtggtgctgccctgaaagtt
gctgacttcaaaggtatcattgacgcattcaattaa

DBGET integrated database retrieval system