KEGG   Bacteroides fragilis NCTC9343: BF9343_3161Help
Entry
BF9343_3161       CDS       T00239                                 

Definition
(GenBank) putative membrane attached peptidase
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
bfs  Bacteroides fragilis NCTC9343
Brite
KEGG Orthology (KO) [BR:bfs00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bfs01002]
    BF9343_3161
Enzymes [BR:bfs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     BF9343_3161
Peptidases and inhibitors [BR:bfs01002]
 Metallo peptidases
  Family M49: dipeptidyl-peptidase III family
   BF9343_3161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-ProteinID: CAH08942
GeneDB: BF3247
UniProt: Q5LAD1
Position
complement(3820662..3822713)
Genome map
AA seq 683 aa AA seqDB search
MKKHLISMAATVILLTACGGAKKTNTAEADNFKYTVEQFADLQILRYRVPGFENLTLKQK
ELVYYLTQAALEGRDILFDQNGKYNLTIRRMLETIYTDYTGDRNSPDFVNLTTYLKRVWF
SNGIHHHYGSEKFVPGFTPEFLKQALLSVDASKLPLAQGQTVEQLFEELSPVIFDPKVMP
KRVNQADGEDLVLTSASNYYDGVTQQEAEAFYNALKNPKDETPVSYGLNSRLVKEDGKII
EKVWKVGGLYTQAIEKIVYWLKKAEGVAEDDAQKAAIGKLIEYYETGDLKTFDEYAILWV
KDLNSRVDFTNGFTESYGDPLGMKASWESIVNFKDLEATRRTELISSNAQWFEDHSPVDK
QFKKEKVKGVTAKVITAAILGGDLYPSTAIGINLPNSNWIRSHHGSKSVTIGNITDAYNK
AAHGNGFNEEFVYSDTEKQLIDKYADLTGELHTDLHECLGHGSGKLLPGVDPDALKAYGS
TIEEARADLFGLYYVADPKLLELGLVPSEDAYKAEYYTYLMNGLMTQLVRVEPGNSVEEA
HMRNRQLIARWVFEKGKADKVVEMVQKDGKTYVVVNDYQKLRHLFGELLAEIQRIKSTGD
FDAARSLVETYAVKVDPGLHSEVLTRYKKLNLAPYKGFVNPRYDAVIDEQGNIVDVQVTY
DEGYAEQMLRYSRDYSPLPSIND
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacatttaatttcaatggctgcaaccgtaatcttgttgactgcttgcggcggc
gccaaaaaaacaaacactgctgaggcagataattttaaatatacagtggaacaatttgca
gacttacagatattacgctatcgcgtacccggatttgagaatttaactctcaaacaaaaa
gagctggtatactatctgactcaagctgcgctcgaaggaagagatatcctgttcgatcag
aacggaaaatacaatcttaccatccggaggatgcttgagacgatctatacggattatacg
ggtgacagaaacagcccggactttgtgaatctgaccacctatctgaagcgtgtgtggttc
tcgaacggtattcatcaccattatggctcggagaagtttgttccgggctttacaccggag
tttctgaagcaggcattgcttagtgttgacgcttcgaagctccctttggctcaagggcag
acggtagaacaactttttgaagaactgtctcccgtgatcttcgatccgaaggtaatgccg
aaacgtgtgaatcaggccgatggtgaagacttggtgctaacttcggccagcaattactat
gacggggtgactcagcaggaggctgaggctttttataatgcgttgaagaatcctaaagac
gaaactcctgtctcttacgggctgaacagccgtttggtgaaagaagacggaaaaataata
gagaaggtctggaaagtagggggactctatactcaggctatcgagaagattgtgtattgg
ctgaagaaagctgaaggagtggccgaagacgatgctcagaaagcggctatcggcaagttg
attgaatattatgagaccggtgatctgaagacgtttgacgaatatgccattctttgggtg
aaggatctgaattcccgtgttgacttcacaaacggatttaccgaaagttatggtgatccg
cttggcatgaaagccagttgggagtcgattgtgaattttaaagatctggaggccacccgt
cggacagaactgataagcagtaatgcccaatggttcgaagatcactcacctgtggacaaa
cagtttaaaaaggaaaaggtgaaaggagtaactgccaaagtaatcactgccgctatcttg
ggaggagatttatatccctcgactgccattggcatcaacttgcccaattctaactggatt
cgcagtcatcacggttccaagtcggtgactatcgggaatattaccgatgcttataataag
gcggcccacggaaacgggttcaacgaggagtttgtgtacagtgacacagaaaagcagctg
attgataaatatgccgatctgacgggtgaactgcataccgacctgcacgaatgcctggga
cacggttccggaaagttgcttccgggagtcgatccggatgcattgaaagcctatggctct
acaatagaagaggcacgtgccgatctgttcggtctttattatgtagctgatcccaaactg
ctggagttgggactggtgccgagtgaagatgcttataaggccgaatattatacttatctg
atgaatggactcatgacccagttggtgcgtgtcgagccgggcaacagtgttgaagaggcg
catatgcgtaatcgtcagcttattgcccgttgggtatttgagaaaggaaaggctgataaa
gtggtggaaatggtacagaaagatggaaagacttatgtcgtagtaaacgattatcagaag
cttcgtcatctgttcggcgaactgctggccgagatacaacgtatcaagtctaccggagac
tttgacgcagcccgctcattggtggagacctatgccgtgaaagtagacccgggacttcat
tccgaagtattgactcgttataaaaaattgaacctggcaccttataagggatttgtgaat
ccgagatacgatgcggtcattgacgagcagggaaatatagtggatgtacaagtaacctat
gatgaaggctatgccgagcagatgctgcgttatagcagggactattcgccgctgccttct
ataaatgattaa

DBGET integrated database retrieval system