KEGG   Bacteroides fragilis NCTC9343: BF9343_3557Help
Entry
BF9343_3557       CDS       T00239                                 

Definition
(GenBank) putative glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
bfs00480  Glutathione metabolism
bfs00590  Arachidonic acid metabolism
bfs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BF9343_3557
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BF9343_3557
Enzymes [BR:bfs01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BF9343_3557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF823
Motif
Other DBs
NCBI-ProteinID: CAH09338
GeneDB: BF3656
UniProt: Q5L992
Position
complement(4312195..4312689)
Genome map
AA seq 164 aa AA seqDB search
MAAQNKSFYDFTVKTIDGKEYPLSGLKGKKVLVVNVASKCGLTPQYAELQELYDQYKDQN
FVIIGFPANNFMGQEPGTNEEIAKFCSVNYDVTFPIMAKISVKGKDMAPLYHWLTEKKLN
GKQDAPVQWNFQKFMIDENGNWVGFVAPKESPFSETIISWIEKK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcagaataaatcattctatgacttcacagtgaagaccatagatggcaaagag
tatccactgtcaggtctgaaaggtaagaaggtgctggtagtgaatgtcgcctccaagtgt
ggactgactccgcaatatgcagagttgcaggagttgtatgatcagtataaagatcagaat
tttgtgattattggctttcctgccaataacttcatgggacaagagccggggacaaacgaa
gagatcgccaaattttgttcggtgaactatgatgttaccttcccgataatggccaagata
tcggtaaagggtaaagatatggctccgctttaccactggttgacagagaagaagctgaac
ggaaagcaagatgcgccggtacagtggaattttcagaagtttatgattgatgagaatgga
aattgggttggttttgtagctcccaaagagagtcctttttcagagacgataatcagttgg
atagaaaaaaagtaa

DBGET integrated database retrieval system