KEGG   Bacteroides fragilis NCTC 9343: BF9343_4183
Entry
BF9343_4183       CDS       T00239                                 

Gene name
metG
Definition
(GenBank) putative methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bfs  Bacteroides fragilis NCTC 9343
Pathway
bfs00450  Selenocompound metabolism
bfs00970  Aminoacyl-tRNA biosynthesis
bfs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BF9343_4183 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BF9343_4183 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bfs01007]
    BF9343_4183 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bfs03016]
    BF9343_4183 (metG)
Enzymes [BR:bfs01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BF9343_4183 (metG)
Amino acid related enzymes [BR:bfs01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BF9343_4183 (metG)
Transfer RNA biogenesis [BR:bfs03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BF9343_4183 (metG)
 Prokaryotic type
   Other AARSs
    BF9343_4183 (metG)
SSDB
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1 tRNA-synt_1e WHEP-TRS DUF5512
Other DBs
NCBI-ProteinID: CAH09964
GeneDB: BF4297
UniProt: Q5L7I8
Position
5101378..5103417
AA seq 679 aa
MEKNFKRTTVTSALPYANGPVHIGHLAGVYVPADIYVRYLRLKKEDVLFIGGSDEHGVPI
TIRAKKEGITPQDVVDRYHFLIKKSFEEFGISFDVYSRTSSKTHHELASDFFKKLYEKGE
FIEKTSEQYYDEEAHQFLADRYITGECPHCHSEGAYGDQCEKCGTSLSPTDLINPKSAIS
GSKPVMKETKHWYLPLDKHETWLRQWILEEHKEWRPNVYGQCKSWLDMGLQPRAVSRDLD
WGIPVPVEGAEGKVLYVWFDAPIGYISNTKELLPDSWETWWKDPETRLVHFIGKDNIVFH
CIVFPAMLKAEGSYILPDNVPSNEFLNLEGDKISTSRNWAVWLHEYLEDFPGKQDVLRYV
LTANAPETKDNDFTWKDFQARNNNELVAVYGNFVNRAMVLTQKYFEGKVPAAGELIDYDK
ETLKEFSDVKAEVEKLLNVFKFRDAQKEAMNLARIGNKYLADTEPWKLAKTDMERVGTIL
NISLQLVANLAIAFEPFLPFSSERLRQMLNMDSFDWAELGRNDLLPAGHQLNKPELLFEK
IEDATIEAQVQKLLDTKKANEEANYKAKPIRANIEFDDFMKLDIRVGTVLECQKVPKADK
LLQFKIDDGLETRTIVSGIAQHYKPEELVGKQVCFIANLAPRKLKGIVSEGMILSAENND
GSLAVVMPGREVKPGSEVK
NT seq 2040 nt   +upstreamnt  +downstreamnt
atggaaaagaactttaaaagaactaccgtcacatcggcactgccgtatgcgaacggcccc
gtccatatcggccatttggccggtgtatatgtaccggcagacatctatgtccgctatctg
cgactgaaaaaagaagatgtacttttcatcggaggctccgacgaacatggggtacccatc
accatccgtgccaaaaaggaaggtatcactccgcaggatgtagtagaccgctatcacttc
ctgattaagaaatcattcgaagaattcggtatctcgtttgacgtatacagccgtacatcg
tccaaaacacaccacgaactggcttcagacttcttcaagaagctatacgaaaaaggagag
tttatcgaaaaaacttcggaacaatattatgatgaagaagcacaccagtttctggccgac
cgctacatcaccggtgaatgtcctcactgtcattcggaaggtgcctatggtgaccaatgc
gaaaagtgcggaacttcactgtcgcccactgacctgattaatccgaaaagtgccatcagc
ggaagcaaaccggtcatgaaagaaaccaaacattggtatctgccacttgacaaacatgaa
acatggctgcgccagtggatattggaagaacacaaagaatggcgtccgaacgtgtacgga
cagtgcaaaagctggctcgatatgggtttgcagccgcgtgcggtcagccgtgacctcgac
tgggggattcctgttccggtagagggtgctgaaggtaaagttctctacgtatggttcgat
gcaccaatcggttacatatccaatacaaaagaactgcttcccgattcatgggaaacctgg
tggaaagatcccgaaacccgtttggttcactttatcggaaaagataatatcgtatttcac
tgcatcgtatttccggctatgctgaaagctgaaggcagctatatcttgccggataatgta
ccgagcaacgaatttctgaatctggaaggagacaaaatatccacttcacgcaactgggca
gtgtggttacacgagtatctggaagacttccccgggaaacaggacgtattgcgttatgta
ttgacagccaatgcacccgaaaccaaggacaacgactttacctggaaagacttccaggca
cgcaataacaacgaattggtagcggtctacggtaactttgtgaaccgtgcgatggtattg
acacagaagtacttcgaaggtaaagtacccgctgcgggcgaacttatagattatgacaaa
gagacactgaaagaattctccgatgttaaagccgaagtagaaaagctgctcaatgtattc
aagttccgtgatgcacagaaagaagccatgaatctggctcgtatcggaaacaaatacctg
gccgatacagaaccctggaaactggcaaagacggatatggaacgtgtaggtactatcctg
aatatatctctgcaactggtagccaacctggctatcgctttcgaaccatttcttccgttc
agttcggaacgcttacgccagatgctgaacatggatagcttcgactgggcagaactggga
cggaacgacctgcttcctgccggacatcaactgaataagccggaattattgttcgaaaag
atagaagatgccacaattgaagcacaagtacaaaagttgctcgatacaaagaaagcaaac
gaagaggctaattacaaagccaaaccgatccgcgccaatatcgaatttgacgacttcatg
aaactcgatattcgcgtaggtactgttctcgaatgtcagaaagtgcctaaggccgacaaa
ttattgcagtttaaaatagacgacggactggaaacacgcaccatcgtcagcggcattgca
caacattacaaaccggaagagctagtaggcaagcaagtttgcttcatcgccaatctggct
ccacgaaagctgaaaggtatcgtcagcgaaggtatgatcctgagtgccgaaaataatgac
ggcagcctggccgttgttatgcccggacgggaagtgaagccgggaagtgaagtgaaataa

DBGET integrated database retrieval system