KEGG   Botrytis cinerea: BCIN_01g00590Help
Entry
BCIN_01g00590     CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
bfu  Botrytis cinerea
Pathway
bfu00790  Folate biosynthesis
bfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BCIN_01g00590
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bfu04147]
    BCIN_01g00590
Enzymes [BR:bfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     BCIN_01g00590
Exosome [BR:bfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCIN_01g00590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a DUF2862
Motif
Other DBs
NCBI-GeneID: 5427719
NCBI-ProteinID: XP_001547231
UniProt: A0A384J405
Position
1:complement(join(245662..245871,245938..246000,246286..246699))
Genome map
AA seq 228 aa AA seqDB search
MKILLRSIFQAPLTAFRPISRAPRPSIFGQSNSHHQIRAFLISTPRALQAENLASRQKAT
EKEKSQSDLSTPSTLPKEVGDSATKHTGNVTQQSAPSVTALQESLEPLLRENGGKWVLAD
DGMSMGRVVQFKGFKDAWNFMNAIAAKCKQERHHPEWVNIYNKVFIRWTTHDLPGLTATD
ILMATFCDEQATIHKEVYNISEEPLSKSTQHEKFLSQAHQVADKLSSK
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcctccttcgttccattttccaagccccattaaccgctttccgacctatttca
cgtgcacctcgtccatcaatcttcggacaatcaaattctcaccaccaaatccgcgctttc
ttaatctccacgcccagagctctccaagctgaaaatcttgcctcgagacaaaaagccacc
gagaaagagaaatctcaatcagatttaagcacaccgagtacacttccaaaagaggttggc
gactctgcaacgaagcataccggaaatgtcacccagcaatctgcaccctctgttacagca
ttgcaggaatcacttgaacctctcttgagagaaaacggcgggaagtgggttttagcagat
gatggaatgtctatgggaagggttgtccaattcaagggatttaaagatgcttggaacttc
atgaacgccatcgcagcaaaatgcaaacaagaaagacatcacccagaatgggttaacatc
tacaacaaggtattcatccgctggaccacgcatgatcttcccggtctaacagccaccgat
atcctcatggccacgttttgcgacgagcaagccacgatacacaaagaagtatacaatatc
tcagaagaacccctttctaaaagtacccagcacgaaaaatttctcagtcaagctcatcag
gtcgctgataagttatcgtcgaaatga

DBGET integrated database retrieval system