KEGG   Botrytis cinerea: BCIN_01g05790
Entry
BCIN_01g05790     CDS       T01072                                 

Gene name
BcniiA
Definition
(RefSeq) BcniiA
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
bfu  Botrytis cinerea
Pathway
bfu00910  Nitrogen metabolism
bfu01100  Metabolic pathways
Module
bfu_M00531  Assimilatory nitrate reduction, nitrate => ammonia
bfu_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BCIN_01g05790 (BcniiA)
Enzymes [BR:bfu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     BCIN_01g05790 (BcniiA)
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Fer2_BFD Pyr_redox Rieske Rieske_2 NIR_SIR_ferr Rubredoxin_C Pyr_redox_3 K_oxygenase NAD_binding_7
Other DBs
NCBI-GeneID: 5442000
NCBI-ProteinID: XP_024546342
Position
1:join(2020615..2020769,2020875..2021025,2021080..2023082,2023159..2024224)
AA seq 1124 aa
MSKLQSQVPVEVVEDLSNGASDGVNGSRNENQGSERKKVVVVGLGMVGIAFIEKLMKLDA
KKREYDIVVIGEESHLAYNRVGLTSFFQHRIVENLYLNPKTWYADVPAGSLNYHINTKVV
EICHSSKKVTCASGETVSYDILVLATGSDALVPKQTPGHDAKGVFVYRNIEDLENLIRFS
DQKKDTHGLVVGGGLLGLEAAKAMMDLESYKKVHLIERNKWVLSRQLDSDAGGLVVEQVR
GLGLDVMLSKRVGKIEVTEQNEVKGVVFEDGQEMECSTICFAIGIKARDELARQAGIKCA
ERGGGIVVGDDLSTSVKDVYAIGECASWENQTFGLIAPGIEMADVLSFNLTQAKIHAYRK
FKRPDLSTKLKLLGVEVASFGDFFADRDGPKNLPIRAAKKDKDSSNSSVQLTAEPRVSPV
KALTYKDPFQAVYKKYLFTMDGKYLLGGMMIGDTKDYVKLVPMVKNQKMLDVPPSQFILG
ASKEGDDGGDDLDDDTQICSCHNVSKGDVVHSVKQGTCKSIGDVKSCTKAGTGCGGCMPL
VTSIFNSTMKSMGQEVKNHICPHFNYSRADLYNIISVKGLKTLAEVMREAGNDPESQGCE
ACKPSIGSIFSSLYNKHVISRPLHGLQETNDRFLANIQRNGTFSVVPRVSAGEITPDKLI
LIGNVAKKYNLYTKITGGQRIDMFGAKKQDLLAIWKELVDGGMESGHAYAKSLRTVKSCV
GTTWCRYGIGDSVGMAVRLEERYKSIRSPHKIKGGVSGCVRECAEAQNKDFGLIATEKGF
NIFVGGNGGATPRHSELLAKDVPPDSVVTILDRYLIFYIRTADKLQRTARWLEALPGGIK
YLREVILEDKLGICASLEAQMEELVGSFFDEWKAAIEDEEMRERFNQFDNCDDRVENMDV
QVERGQTRPVDWTKESAKTDFRNVKWTSLNWERVIQKDHFKGADEAPSGVSASVKRGDTQ
LAVWRVQGKWLASQQMCPHKRAFVLSDGLIGDSGPGSITIPGSDGKEEKNLWISCPNHKR
NFNLNGEDKGRCKNDEEVSIAIFEAEEREDGWVYLKLPPVHELDGVLGMERWKVREGEAG
ERQFKKLDEKIGFAMDGGRMKGRKPADRRRELRVGGEGGGGIDW
NT seq 3375 nt   +upstreamnt  +downstreamnt
atgtcgaagttgcaatcgcaggttccggttgaggtggtggaagatttgagcaatggggct
tcggacggggtaaatggatctagaaatgagaatcaagggtcggagagaaagaaggtggtg
gttgttggtttggggatggtggggattgctttcatagagaaattgatgaaactggatgcg
aagaagagagaatacgatatcgttgttataggcgaagaatcacatctagcatacaatcga
gttggtctcacgagtttctttcaacatcggattgtggagaatttgtatctgaatccaaaa
acatggtatgcggacgttcccgccggatctctcaattatcacatcaataccaaggtggtt
gagatttgtcattccagcaaaaaggttacttgtgcttctggcgaaacggtctcgtacgat
atccttgtcttggctacgggatccgatgctcttgtaccgaaacaaacacctgggcatgat
gccaaaggtgttttcgtgtatagaaacatagaggatttggaaaatctcatccggttttcg
gatcagaaaaaggatacacatggacttgtagtgggcggaggactcttgggtctcgaagct
gcaaaagccatgatggatcttgagagttataagaaagtacatctgatcgagaggaacaag
tgggtgttgagtcgtcagcttgattctgatgctggaggcttggtggtcgaacaagtgaga
ggactaggtttggatgtcatgttgtccaaacgagttggaaaaatcgaggtgacggagcag
aatgaagtgaaaggtgtggtgtttgaagatggacaagaaatggaatgctcgactatctgt
tttgcgatcggcatcaaggctcgagatgaacttgctcgtcaagcaggaattaaatgcgct
gaacgcggcggaggaattgtcgtaggagatgatttaagtacaagtgtcaaagatgtctac
gcaattggcgagtgtgctagttgggaaaatcaaacgttcggactgattgcccctgggatc
gagatggcagatgtgttgtctttcaacttgacacaagcaaagatacacgcatatcggaaa
tttaagcgacctgacctcagcacgaagttgaagctgttaggggtggaggttgcgagtttt
ggggatttctttgcggacagagatggtcctaaaaatctaccgatcagggcggcgaagaag
gacaaagattcttccaattcttcggtacagttgactgctgaacccagggtatcaccagtc
aaggcacttacttacaaagatcctttccaagctgtctacaagaaatatctattcaccatg
gatggaaaatacctcttaggcggtatgatgattggggacacgaaagattacgtcaagctg
gtaccgatggtaaaaaatcaaaaaatgctagatgtgccacctagtcaattcatcctcgga
gccagcaaggaaggtgatgatggtggagacgacttggatgacgacacccaaatatgctca
tgtcacaatgtaagcaaaggagatgttgtgcattcggtcaagcaaggcacatgcaaaagt
atcggagacgtcaaatcatgcaccaaagccggaacaggatgtggtggctgcatgcccctg
gtgactagcatcttcaacagcactatgaaatctatgggccaagaagtcaaaaatcacatt
tgtcctcatttcaactattctcgcgctgatctttataacattatttctgtcaagggcctg
aagactctagcggaggttatgagagaagcgggaaatgatcccgagagtcagggatgcgaa
gcttgtaaaccttcgatcggatcgatcttcagctcgctctacaacaaacatgtcatttcg
cgtccgctgcatggtcttcaagagaccaacgatcgtttcttggcgaacatacaacgaaat
ggtactttctccgtcgtacccagagtatcggcgggagaaatcacgccggataaattaatc
ctgataggaaatgtagcgaagaagtataatctctacaccaagatcactggaggtcagaga
atcgatatgtttggagcgaagaaacaagatcttctggctatctggaaggaactggtagat
gggggtatggaatctggccatgcgtatgcaaagagtttgcggactgttaaaagttgtgtg
ggaacgacttggtgtcgatatggtattggagattcggtgggcatggctgttagattggag
gagaggtacaagagtattagatcgccgcataagatcaagggaggtgtaagtgggtgtgtg
agggaatgtgccgaggcgcagaataaagatttcggacttatagccacagaaaaaggtttc
aacattttcgttggcgggaatggtggggctacacctcgtcacagcgaactcctagccaaa
gacgtcccaccagattccgttgtcaccatcctagatcgctacctcatcttctacatccgc
acagccgataaactgcaacgtacagctcgatggctagaagctcttcccggtgggatcaag
tatctccgcgaagttatcttggaagataagctaggtatttgtgctagtttggaagcgcag
atggaggagctagtggggagtttcttcgacgaatggaaagctgcgattgaagacgaggaa
atgagagaaaggttcaatcagtttgataattgtgatgatagggtggaaaatatggatgtg
caggttgagcgtggacaaacgagaccggtggactggacgaaggagagtgcgaagacagat
ttccggaatgtgaaatggacgagtttgaattgggagagggtgattcagaaagatcatttc
aagggcgcggatgaggcgcccagtggggtttcagcaagcgtgaagaggggggatactcaa
ttggctgtttggagagtgcaggggaagtggctggctagtcagcagatgtgtccgcataag
agggcgtttgttttgagcgatgggttgattggagattctgggcctggttctattactatt
cctggaagtgatgggaaggaggagaaaaatctttggatctcctgtccgaatcataagagg
aattttaatttgaatggagaggataagggaaggtgtaagaatgatgaagaggttagcata
gcgatttttgaggccgaggagagagaggatggatgggtgtatttgaagttgccgccggtg
catgagttagatggagtgttggggatggagaggtggaaagttagagagggggaggcaggc
gaaagacagtttaagaagttggatgagaagattgggtttgcgatggatggggggaggatg
aaggggaggaagcctgcggacaggaggagggaactgagggttgggggagagggaggtggt
ggtattgactggtaa

DBGET integrated database retrieval system