KEGG   Botrytis cinerea: BCIN_02g07040Help
Entry
BCIN_02g07040     CDS       T01072                                 

Definition
(RefSeq) Bcvps41
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
bfu  Botrytis cinerea
Pathway
bfu04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    BCIN_02g07040
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bfu04131]
    BCIN_02g07040
Membrane trafficking [BR:bfu04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    BCIN_02g07040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Clathrin Vps39_1 PQQ_3 WD40_like
Motif
Other DBs
NCBI-GeneID: 5427864
NCBI-ProteinID: XP_024547258
Position
2:complement(join(2491353..2492168,2492217..2493930,2493991..2494994,2495048..2495074,2495126..2495386))
Genome map
AA seq 1273 aa AA seqDB search
MAEGSEEQSDTKNLDSVESSQGGTETGDDDDTVETESEDGEEEEEEDDEDEEEEEPKLKY
ARMTTHLGPVYRNGDATSTFLVAGDKMFIGTHNGNIHVLSLPSFKSIRTYHAHSASITSI
SISPFPPPLPTPVPEAVQRFTSRVQTEAPNAPQRAPSMASQASTNTARSPGGPVVPKTPS
NAIYIGTSSVDGKVCIASLVDVKDVQLRDFARPVQAVSLSPDYKNDRSYISGGLAGNLVL
TVGGKAGTSSTSTTTGSAAATASGWLGTIGLGTHAGKDTVLHSGEGTINTIKWSLSGRYV
AWSNEHGIKIMRSHLQLDSADTESAWKRIGHIPRPDGEQWEDMASVWKARVEWIDEKTLE
TDEDDKAREASSASPATAKLRLQASRDKLRIEKLVVGWGGTIWMINVHPGGTGVGKNVGE
RTVGSAEIIKMLRMDCIISGLSLYTPTLLVVLAYVMPDEEDEESKTPKGHKSHPSTGSEP
SGGIRRRQNALSPELRLIDLGTSQEVDTDGLTVSRYERLSAGDYHLCVLPAARDQPVVQT
SRGTLEALTGMGSGMWNATINATALLSSSASVISNGSTGDGDSKHTSIKSKLAHHNRATA
AHPHIITPGMKIFIQSPYDCILATKRDLSDHLSWLLEHEKHQEAWELIDEHPEVISSSPE
KLSEIGPATPDRTRSSSDDFYDNESTTIESASRLINSSVEKEKRRIGELWIQSLVENDDW
TSAGRICGKVLGTSDRWEHWVWTFAGKDKFDEITNFIPTAQITPPLPSTIYEIVLGHYIT
HNLPRVGELLDQWSPDLFDIKAVATALENQLKYRDVRQDSVEDGKIGRDWRIVMESLGKL
YVADGRTREALKCYMKLQDADTAMGLIKQYHLVDAVADDLPSLIMLRVSKEQKRHAPISE
LKEATSEAIQLLVDEAHHGLVRPQIVVDQLEEMPLYLFFYVSSLWKGDGIDEISGENRDR
LLAESRSLVDSLADLALQLFATYDRDLLMEFLKSSTFYSFEKATLECENHSYIPELVYLY
SKTGQTKRALYLIIDRLADVSQAISFAKSQNDADLWDDLLEYSMDKPRFIRGLLEEVGTA
IDPIRLVRKIPEGLEIEGLREGLSRMIKEYEIQESISQGVARVLRGEVAMAQNTLRAGQR
RGVKFDVAEQEFEVDNDTQQPPARRVYKHKPAHCISCKSAFYEGEMETLVGFACGHVWHL
SHLLNYGKSEDQIRQSEDAERHPTYDGFDDGDNERRYTNVHSIGTKVTRARLLKDRIRGG
CPVCKGKSDGAYA
NT seq 3822 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagggtcagaagaacaaagcgacaccaaaaacctggacagtgttgagtccagt
caaggtggaactgaaaccggggacgatgatgacaccgttgaaacagaatcggaggatggg
gaggaggaggaggaggaggatgatgaagatgaagaggaggaagagcccaagctaaaatac
gctcgaatgacaacccatcttggtccagtctatagaaatggagatgctacaagtaccttc
ctggttgctggcgacaagatgtttattggtacacataatggtaacattcatgtactgtcg
ttgccttcattcaaatcgattcgaacctaccatgcccactcggcttcaattacgagcata
tccatatcccctttccctcctccactacccacgccagttcccgaagctgtacagcgcttt
acatcgcgagtgcaaacagaagctcctaatgcaccgcaaagagctccatcaatggcatca
caggcctccacaaacacagctcggagtcctggaggtccagtagtccccaaaactccttcg
aacgcaatatacattggcacgtcttccgttgatggcaaggtatgcatagcatccctggtt
gatgtaaaagatgtacaattgagggatttcgcaagacctgtccaagctgttagtttatcg
ccggattacaaaaacgatcgttcatatatatcgggaggactggcaggaaacctagtgctt
accgtcggcggtaaagcaggtacaagctcgacttctaccactacaggaagtgcagcggcc
actgcaagtggctggctggggactattggtctaggaacgcatgctgggaaggatactgtg
ttgcactccggcgaaggcacaattaataccatcaagtggtccttatcgggaagatatgtg
gcatggagcaatgagcatggtatcaaaatcatgaggtctcatctgcaactggatagcgcg
gatactgaatcagcttggaaacgaattgggcacatacctcgtccagatggagagcaatgg
gaagatatggccagtgtttggaaagctagagttgagtggatagacgagaaaactcttgaa
actgatgaagatgacaaagctcgtgaagcatcatctgcttccccggccacagcaaaattg
agattgcaagcctcgagagacaaactgcgtattgaaaaattagtcgttggatggggcggt
acaatctggatgatcaatgtgcaccctggtggaaccggggttggaaagaatgtgggagag
cgcacagttggtagcgcagaaatcatcaaaatgttacggatggattgtataatttctgga
ttatcgttatataccccaactttacttgttgtacttgcttatgttatgcctgatgaagaa
gacgaggaatccaagacaccgaaagggcacaaatcgcatccgtcaacaggtagcgagccg
agcggtggaatacggcgtcgacaaaacgcactatctccagaacttcgtcttattgatctt
ggaacatcccaagaagtcgataccgatggattgacggtcagtcgttatgaaaggctctca
gctggtgattatcatttgtgcgtattacctgccgctcgagatcaaccagtagttcaaaca
tctcgtggaactttggaagcccttactggaatgggcagtggtatgtggaatgctacaatt
aatgctacagcgctgctgagttccagtgcaagtgtgatcagcaatggaagcacaggcgat
ggtgattccaaacacacatcgattaaatcgaagcttgctcaccacaatcgcgccacggct
gcccatccgcatatcatcacaccagggatgaaaattttcatccaaagtccatatgactgc
attctagctacaaaacgagatttatcagaccatctttcatggttattagagcacgaaaag
caccaagaggcctgggaattaattgatgaacatcccgaagtgatttcttcttctcccgag
aaactttccgaaatcggcccagcaactccggatcgaacacgctcaagtagtgatgatttc
tacgataacgaaagcacgaccattgaatccgcaagtcgcttgattaactcttctgtggaa
aaagagaagcgtaggatcggtgaactttggattcaatcattggttgagaatgatgattgg
acctctgcaggcagaatatgtggcaaagtgctgggtacatcggatcggtgggaacattgg
gtctggacatttgctggaaaggataaatttgatgaaattaccaactttataccgacagcg
cagatcacgccacctctgccttcgacaatctatgaaatcgtactgggacattatatcacc
cataacttaccacgagttggtgagttgctcgaccaatggtctcctgacctgttcgatatc
aaagctgtagccacagctctagaaaaccagctcaaatatcgtgacgtccgccaagacagc
gtagaggatggcaaaatcggcagagattggcgaattgtcatggaaagcttagggaagctt
tacgtggctgatggtcgaactcgcgaggctttgaaatgttacatgaagctgcaggatgca
gacaccgccatgggtcttatcaaacaatatcatttggttgacgcggtcgcagatgatcta
cccagtcttatcatgcttcgcgtttcgaaagagcagaagcgacatgctcctatttcggaa
ttaaaagaagccacttccgaggctattcaactacttgttgacgaggctcaccacggtctt
gttcgacctcagattgtcgtggatcagttggaagaaatgccattgtacctcttcttctat
gttagctcgctctggaaaggagacggaatagacgaaatttcaggcgagaatcgtgatcga
ttattagcagaaagtagatcgcttgtcgatagtctggctgatttagctttacaactcttc
gcgacatatgatcgtgatcttcttatggagttccttaagtcgtccaccttctatagtttc
gaaaaggcaacacttgaatgtgaaaatcactcatacatcccagagctcgtgtatctctac
tctaagaccggtcaaacaaaacgtgcgctctatctcattattgatcgtctagcagatgtc
tcacaagcaatatcatttgcaaaatctcagaatgacgccgacctttgggatgatcttctc
gaatactctatggataagccccgattcattcgcggattgttggaagaagttgggacggcg
attgatccaatccgactagttcgcaaaatccctgaaggtttggagattgaaggcttgagg
gaaggtctaagcagaatgatcaaggaatatgaaattcaagaaagcatcagtcaaggagta
gcaagagtattaagaggcgaagtcgcaatggctcagaatacccttcgagcaggtcagcgt
cgtggcgtcaaatttgatgttgctgaacaggaattcgaggtggataatgacacccaacaa
ccacctgcaagacgagtatacaaacacaagcctgcacattgcataagttgcaaaagcgcc
ttttatgaaggtgagatggagacgctagttggttttgcatgcggccatgtgtggcactta
tcacatttattgaattacggtaaaagtgaagatcagattcgtcaatccgaagatgcagaa
agacatcctacttatgatggatttgacgatggggataatgagcgcaggtacacgaacgtg
catagtattgggactaaagtcacgagggcgaggttgttaaaggataggatcagaggcggc
tgtcctgtatgcaaaggcaagagcgatggtgcttatgcttaa

DBGET integrated database retrieval system