KEGG   Botrytis cinerea: BCIN_03g06940Help
Entry
BCIN_03g06940     CDS       T01072                                 

Gene name
Bcnip1
Definition
(RefSeq) Bcnip1
  KO
K03252  translation initiation factor 3 subunit C
Organism
bfu  Botrytis cinerea
Pathway
bfu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    BCIN_03g06940 (Bcnip1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bfu03012]
    BCIN_03g06940 (Bcnip1)
Translation factors [BR:bfu03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    BCIN_03g06940 (Bcnip1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: eIF-3c_N PCI
Motif
Other DBs
NCBI-GeneID: 5436074
NCBI-ProteinID: XP_001555507
UniProt: A6S043 A0A384JD07
Position
3:complement(join(2342564..2343841,2343892..2344862,2344920..2345280))
Genome map
AA seq 869 aa AA seqDB search
MSRFFRGDSSSDSSSDEEEDLYSDDEEVQEQPEEESSEDDSEEDDDDDDDSDSSSDDGAG
KKTGANAFLKDDSDSDSESSGDEGVKVVKSAKNKRFEELEATAKAIENGEKINDWGSISA
EFDKLNRQVAKLLQSGTIPKVYIKAIADLEDFMNETLAKQKVTPKKMNATNSRGLNAVKQ
KIKKASKEHQKDIDSFRADKDAYMESEDEEVVAPKQKKPRSSAAQDVAADDDDEGWGTVG
KGGRTLQFTPESILKHLRTILESRGKKNTDRNEQIKIMEKLYEVAATPYQRIRVLLTIIS
TRFDMTTGTQTFMSQEQWKAAEKEFGTLLSVLETSREYVVVETAEPWEDDEKLPTVAEGG
KFAIPGSVVSYVERLDDELTRSLQHIDPHTAEYIERLSDESDLYNNIVRTMLYQEEISKD
ASLNEPQRSLNRVVMRRLEHVYFKPSAVIKILDENCWKAVPAELNSTITPRGSVEDAKTL
VNVLCNYLYINTEGEGLTKARAMLCQIYFEALHDNYYKARDMMLMSHLQETINSFDVHSQ
ILFNRTLVQVGLCAFRAGLVYEAQTTLQEICGSGRQKELLAQGVMIQRYNQVTPDQERLE
KQRQLPFHMHINLELLECVYLTCSMLLEIPLFAQTGSSPDIKKRVISKTYRRMLEYHERQ
IFTGPPENTRDHVMQASKALAQGEWKRATEFIHSIKIWELMSKPEEIKAMLSAQIQEEGL
RTYLFTYAPYYDTLSVSRLSSMFDLSDRKVAAIVSKMISHEELAAALDQVSSSIIFRKGV
ELSRLQSLALSLSDKASGLIESNERTLETRTQGTANAFERQGGRGGRGGNRGGRGGGRGG
RGGISNAPRQAGGTQFTGGALGAAVGSRA
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgtctagatttttccgcggtgatagctccagcgacagctcctccgacgaggaggaggat
ctctattccgatgacgaagaagttcaagaacagcccgaagaagaatcttctgaagatgat
tctgaggaggacgacgatgatgatgatgactccgattccagcagcgatgatggagctggc
aaaaagaccggagcaaacgctttcttgaaggacgattccgattccgatagtgaaagcagt
ggagatgagggcgtgaaggtcgtcaagtctgcgaagaacaagcgattcgaagaactcgag
gcaaccgcaaaagctattgaaaatggcgagaagatcaacgattggggatcgatctcagca
gagttcgacaaattgaaccgccaagtcgccaaacttctacaatcaggcacaatcccaaag
gtctacatcaaagctattgctgatttggaggacttcatgaatgagaccttggcaaagcag
aaggtgacaccaaagaagatgaacgccacaaattctcgcggtttaaacgctgttaaacag
aagatcaagaaggccagcaaggagcaccagaaggatattgactcattcagagccgataag
gacgcgtacatggaatcagaagatgaggaagttgtggcaccaaaacaaaagaaaccaagg
tcctctgcagcgcaggatgttgccgccgacgacgatgacgaaggatggggaactgttggt
aagggtggacgaactcttcaatttacaccagaaagtattctcaagcacttgaggaccatt
ctcgagtccagaggaaagaagaacaccgaccgcaatgaacagattaagattatggagaag
ttatacgaagtagcagctactccataccaacgcatcagagttcttttaaccatcatttca
acaagattcgacatgaccactggtactcaaactttcatgtcccaagaacaatggaaagca
gcagagaaggaatttggaaccctccttagtgttctcgagacaagtcgagaatatgtagtt
gtggagaccgccgaaccttgggaggacgatgaaaaacttcccaccgttgccgaaggcgga
aagttcgcgattccaggaagcgtcgtctcctacgtcgaaagacttgatgatgaacttaca
agatcgcttcaacacattgatcctcacaccgctgaatacatcgagcgtctttctgacgag
agtgatctttacaacaacattgtcagaactatgttgtaccaggaggaaatcagcaaggat
gccagcttgaacgagcctcaacgtagcttgaacagagttgtcatgagaagattggagcac
gtatacttcaagccatccgcagtcatcaagattctcgacgagaactgctggaaagcagtt
cctgcagagctcaactcgaccatcacaccacgcggctccgttgaagatgccaagaccttg
gtcaacgttctctgcaactacctctacatcaacactgagggtgaaggacttactaaagca
agggccatgctttgccaaatctatttcgaagctttacacgacaactactacaaggctcgt
gatatgatgcttatgtctcatttgcaagagactatcaattcgttcgatgttcacagtcaa
attttgttcaaccgtactctcgttcaagttggtctctgtgctttccgagctggtttggtc
tatgaggctcaaaccaccctccaagaaatctgtggtagtggtcgtcaaaaggaattgctt
gctcaaggtgtcatgattcaaagatacaaccaagtcacaccagatcaagaacgtctcgaa
aaacaacgtcaactcccattccacatgcacatcaacctcgagcttcttgaatgtgtttac
ctcacctgcagcatgcttctcgaaattcctctattcgcacaaactggctcatctcccgat
atcaagaagagagttatcagcaagacatacagacgtatgctcgaataccatgagcgtcaa
atcttcactggacctcctgaaaacaccagagatcatgtcatgcaagcatcaaaggctttg
gcccaaggtgaatggaagagagcaaccgaattcatccactcgattaaaatttgggaactt
atgtccaagcctgaggagatcaaggcaatgctctcagcgcaaatccaagaagaaggtctc
cgaacctatctctttacatacgctccttactacgatactctatccgtcagcagactctca
tcaatgtttgatctctctgaccgaaaggttgctgccattgttagcaagatgatcagccac
gaggaacttgcagccgcattagaccaagtcagctcctcgatcattttcagaaagggtgtt
gagttgagcagactccaaagcttagcattgagcctcagcgacaaagctagtggcttgatt
gaaagcaacgagcgtacactcgagacaagaacacaaggcacagccaatgcatttgaaaga
caaggcggtcgaggtggacgtggtggtaacagaggaggccgtggtggtggacgtggtgga
cgtggtggtatctccaatgctccaaggcaagctggtggaacacaatttaccggtggtgct
ttgggagctgctgtaggtagcagagcttaa

DBGET integrated database retrieval system