KEGG   Botrytis cinerea: BCIN_03g07070Help
Entry
BCIN_03g07070     CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K00877  hydroxymethylpyrimidine/phosphomethylpyrimidine kinase / thiaminase [EC:2.7.1.49 2.7.4.7 3.5.99.2]
Organism
bfu  Botrytis cinerea
Pathway
bfu00730  Thiamine metabolism
bfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BCIN_03g07070
Enzymes [BR:bfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.49  hydroxymethylpyrimidine kinase
     BCIN_03g07070
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.7  phosphooxymethylpyrimidine kinase
     BCIN_03g07070
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     BCIN_03g07070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phos_pyr_kin TENA_THI-4 PfkB Carb_kinase
Motif
Other DBs
NCBI-GeneID: 5430392
NCBI-ProteinID: XP_024547899
Position
3:join(2402935..2402987,2403056..2403237,2403321..2403403,2403453..2403837,2403887..2404046,2404097..2404247,2404297..2404362,2404416..2404524,2404577..2404595,2404646..2404842,2404903..2404982,2405136..2405183)
Genome map
AA seq 510 aa AA seqDB search
MGVGRVLVIAGSDSSGGAGIEADQKVIAAHGCYAMTATTALTAQNTLGVEDIHYVPAEFV
GKLIDVSIGDVGVDVVKTGMLASGETVEVVAKALKRHHVKSLIVDPVMVSTSGSQLLPSA
AIRQLRELLFPYTTVLTPNVPEAQLLLSDAGKSVEEPKNLDDLKEIAKAVQSLGPRYVLV
KGGHLPLQKDGTVATKEEEKELMVDILYGEGVITEIRTRYQKSRNTHGTGCSMASAIASN
IANGLPVVQAVRSACRYIEAGIRTAPDLGNGNGPINHFHSTYTLPFASGHFVEYLLDRPD
VKGAWRDHTEHAFVKGLGDGTLPLESFKYYLIQDYLYLVQFARANALASYKVKTMEGIAA
SAGIVLHIHREMALHINYCEGFGMTKAEIEACEESQACTAYTRYVLDIGQSEDWLALQIS
MAPCLIGYGEIAKRLHADPKTKREGNIYWKWIENYVADDFTEAVKVGSALIEKHASLQSP
NRIEELVKIFVHATKMETGFWDMGGGGGKN
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgggagtaggacgtgtacttgtcatcgcgggttctgatagttccggtggagccggaatc
gaagccgatcaaaaagtgattgctgcacatggatgctatgctatgaccgccacaacggcc
ttgacggctcaaaacactctaggtgttgaggatatccattatgttcctgccgaatttgtt
gggaagttgattgatgtgtcgattggggatgtgggggttgatgtagtgaaaactggcatg
ctagcatctggggaaacagtagaagtggtggcaaaagcattaaaaagacatcacgtgaaa
tctttgattgttgatcctgtaatggtctctacaagtggatcgcagcttttgccttctgca
gcaatccgccagctacgagaacttctgtttccatataccactgttctcacacccaacgtt
cctgaagcgcaactactcctttccgatgctggcaagtctgtcgaagaacccaagaacttg
gatgacttgaaagagatagcgaaagcagtacagtcactaggcccgagatatgtattagtg
aaaggagggcatctgcctttacagaaagatgggacagtggcgactaaggaggaggaaaaa
gaactcatggttgacatcttgtatggagaaggagtcatcacagaaatccggactaggtat
caaaaatcgcggaatactcatggaacaggatgttcgatggcctccgccattgcttcgaac
attgcgaacggattacccgtggtacaagctgtgagaagtgcttgccgatatatcgaagca
ggaatacgaacagcaccggatctagggaacggcaatggtccgattaatcatttccattca
acttacaccttacctttcgcttcgggtcactttgtagaatatcttctggatagaccagat
gttaaaggagcttggcgagaccatactgagcatgcatttgtcaagggacttggagacggg
accttaccactggagtcattcaagtactaccttattcaagattatctttaccttgtgcaa
ttcgctagggctaatgctttagcttcgtacaaagttaaaactatggaaggcattgctgca
tctgcaggtatcgtacttcacattcatcgggagatggcgctgcatatcaattactgtgag
ggttttggtatgacgaaagcagagatagaagcctgcgaagagagtcaagcatgcacagca
tacacaaggtatgttctcgacatcggacaatctgaggactggttggctcttcaaatatcc
atggcgccctgccttatcggctacggggagatagcaaaacgattacatgcagacccaaag
acgaaacgggaaggaaatatctattggaaatggatagaaaattatgttgcagacgatttt
acggaagcagtgaaagttggatcagctctaattgaaaaacatgcttcgctgcagtcaccc
aataggatagaggaattggtcaagatatttgttcatgcaacaaagatggagacaggattc
tgggacatgggtggcggtggagggaaaaattaa

DBGET integrated database retrieval system