KEGG   Botrytis cinerea: BCIN_04g04800Help
Entry
BCIN_04g04800     CDS       T01072                                 

Gene name
Bcbrn1
Definition
(RefSeq) Bcbrn1
  KO
K17739  tetrahydroxynaphthalene reductase [EC:1.1.1.252]
Organism
bfu  Botrytis cinerea
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BCIN_04g04800 (Bcbrn1)
Enzymes [BR:bfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.252  tetrahydroxynaphthalene reductase
     BCIN_04g04800 (Bcbrn1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF1372 DUF881
Motif
Other DBs
NCBI-GeneID: 5438219
NCBI-ProteinID: XP_001557620
UniProt: A0A384JFC4
Position
4:join(1658979..1659111,1659163..1659633,1659692..1659957)
Genome map
AA seq 289 aa AA seqDB search
MSATNGSNGATNGTKEKVDYTKVPGPLGLESASLKGKVALVTGSGRGIGAEMACELGRRG
AKVIVNYANSDSAAQEVVNTIKKAGSEAIALQGNVSVVSDIINLFAQAKKQWGKLDIVCS
NSGVVTFGHIKDVTEEEYDRVMNINTRGQFFVAREAYKNLEVGGRLIMMGSITGQAKGVP
QHTVYSGSKGAIETFVRCMAIDFGDKKITVNCIAPGGIRTDMYHKVCREYIPNGANLNDE
EVDEYAATWSPLHRVGLPIDIARVVCFLASQDGEWVNGKVIGIDGAAMM
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctacaaacggatcaaacggagccaccaatggcactaaggagaaggttgattat
accaaggtcccaggtcctctcggtctcgagagcgccagcttgaagggcaaagttgccttg
gttactggatcaggtcgtggtatcggtgccgaaatggcctgtgaactcggtcgtcgcggc
gccaaagtcattgtaaactacgccaactccgattctgctgcccaagaagtcgtcaacact
atcaagaaggccggttccgaggcaattgccctccaaggaaacgtttccgtcgtctctgac
atcatcaatctctttgctcaagccaagaagcaatggggtaaactcgatattgtttgctcc
aactctggtgtcgttaccttcggacatatcaaggatgtcaccgaggaggaatatgatcgt
gtcatgaatatcaacactagaggtcaattcttcgttgccagagaggcttacaagaatttg
gaagttggaggtcgtttgatcatgatgggttccattactggtcaggctaagggagttcct
caacacactgtctactctggttctaagggtgccattgagactttcgtccgctgcatggct
attgacttcggtgacaagaagattaccgtcaactgcatcgctccaggtggaatccgtacc
gacatgtaccacaaagtttgccgtgaatacattcccaacggcgccaacctcaacgatgaa
gaagtcgatgaatatgccgctacctggtccccactccacagagtcggtcttcctattgat
attgccagagttgtttgcttcttggcgagtcaagatggtgaatgggttaacggaaaggtt
attggtatcgatggtgcagctatgatgtaa

DBGET integrated database retrieval system