KEGG   Botrytis cinerea: BCIN_05g00090Help
Entry
BCIN_05g00090     CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K11594  ATP-dependent RNA helicase DDX3X [EC:3.6.4.13]
Organism
bfu  Botrytis cinerea
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bfu03019]
    BCIN_05g00090
   03041 Spliceosome [BR:bfu03041]
    BCIN_05g00090
   03036 Chromosome and associated proteins [BR:bfu03036]
    BCIN_05g00090
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     BCIN_05g00090
Messenger RNA biogenesis [BR:bfu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     BCIN_05g00090
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     BCIN_05g00090
Spliceosome [BR:bfu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    BCIN_05g00090
Chromosome and associated proteins [BR:bfu03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    BCIN_05g00090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C ResIII CMS1 UTP25
Motif
Other DBs
NCBI-GeneID: 5430884
NCBI-ProteinID: XP_001550389
UniProt: A6SEH9 A0A384JGF9
Position
5:join(50960..51108,51178..52550,52637..53133,53209..53241)
Genome map
AA seq 683 aa AA seqDB search
MADQLNMNGLNLNGGEPRSYIPPHMRGKMGGPAPAGPPANLNGSAWAPQGNGYANGPRPA
GGDSWANAPDFTPRGNGAPRGGNNWNPSGPPSFNKNAYGNPAAGAGGPGGAGGAGGAGGG
AGQARGGGDGQWRDGKHIAGPANARVERELFGIADDPTKQQTGINFEKYDDIPVEASGQD
VPEPVLKFTNPPLDDHLIKNIELAHYKVPTPVQKYSIPIVMGGRDLMACAQTGSGKTGGF
LFPILSQAFQTGPSPVPANAAGSFGRTRKAYPTSLILAPTRELVSQIYDESRKFAYRSWV
RPCVVYGGADIGSQLRQMERGCDLLVATPGRLVDLIERGRISLQNIKYLVLDEADRMLDM
GFEPQIRRIVEGEDMPGVQNRQTLMFSATFPRDIQMLARDFLKDYVFLSVGRVGSTSENI
TQKVEYVEDIDKRSVLLDILHTHGAGLTLIFVETKRMADSLSDFLINQNFPATSIHGDRT
QRERERALEMFRNGRCPILVATAVAARGLDIPNVKHVVNYDLPTDIDDYVHRIGRTGRAG
NTGISTAFFNRGNRGVCRDLIELLKEANQEIPSFLENIAREGGGFGGGRGGRSGGRGRGG
GANRDFRKFGGGGGGGFNGGGGFGGPPASGGYGGGGGGFGGPPAPSSYGPPPGQYGGGGG
GYGGGNGGGYGNPSAGGGGQSWW
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggcggatcaactcaacatgaatggtctcaaccttaacggtggtgaacctcgatcatat
attcctccccacatgcgaggcaagatgggtggccctgctccagctggtccaccagcaaac
ttgaatggcagtgcttgggcccctcaaggtaacggatacgctaatggtccacgcccagcc
ggaggtgattcttgggctaatgctcctgatttcaccccacgtggaaatggtgctccacga
ggtggaaacaactggaacccatctggtcctccatccttcaacaagaacgcttacggaaac
cctgcagctggtgctggcggtcctggaggtgcaggtggtgccggtggcgctggtggcggt
gctggtcaagctcgtggtggtggagatggacaatggcgagatggaaaacacattgctgga
cctgccaacgctcgtgtagaacgcgaactcttcggtattgcggatgatccaaccaagcaa
caaaccggtatcaacttcgaaaagtacgatgatatcccagttgaagcatctggtcaagat
gttccagaaccagtcctcaagttcactaaccctcctctcgatgatcatctcatcaagaac
atcgagttagcacattacaaggtcccaaccccagttcaaaaatactccatcccaattgtc
atgggtggacgtgatttgatggcttgtgctcaaactggttccggaaagactggtggtttc
ttgttccccattttgtctcaagcattccaaactggtccatctcctgttccagctaatgct
gcaggaagcttcggacgcactcgcaaggcttacccaacttccctgatccttgctccaact
cgtgagcttgtttcccaaatttacgacgaatctcgcaaattcgcctacagatcctgggtt
cgcccttgtgttgtttatggtggtgccgatattggctctcaacttcgccaaatggaacgc
ggttgtgatctcctcgttgctaccccaggtcgtcttgtcgatttgattgaacgtggccgc
atttctcttcaaaacatcaaatacttggttctcgatgaggctgatcgtatgttggacatg
ggtttcgaaccacaaattcgacgaattgttgagggtgaggatatgccaggtgttcaaaac
cgtcaaaccctcatgttttcagccaccttccctcgcgacattcaaatgcttgcccgtgat
ttcttgaaggattacgttttcttgtctgttggtcgtgttggttctacttctgagaacatc
actcaaaaggttgaatacgttgaggacattgacaagcgttccgtccttttagacattctc
cacactcacggtgctggtcttaccctcatcttcgtcgagactaagcgtatggccgattcc
ttgtcagacttcttgatcaaccaaaacttccccgccacttctatccacggtgatcgtact
caacgtgagcgtgagcgtgctctcgagatgttcagaaatggtcgttgcccgattcttgtc
gctactgctgtcgcagccagaggattggacattcccaatgttaagcatgtagtcaactac
gaccttcctactgacatcgatgactacgttcatcgtatcggtcgtacaggtcgtgctggt
aacactggtatctcaactgcgttcttcaaccgtggaaaccgtggtgtctgtcgcgatctt
attgaactcttgaaggaagctaaccaagagattccatccttcctcgagaatattgctcgt
gaaggtggtggttttggtggcggacgtggtggtcgatcaggtggtcgtggacgtggtggt
ggagctaaccgtgatttccgtaaatttggcggaggtggcggtggtggattcaacggaggt
ggtggatttggcggacctccagcctctggtggatatggtggtggtggtggcggcttcggt
ggcccacctgctccttctagctatggacctccaccaggacaatacggtggtggtggcggt
ggttacggcggcggaaatggtggcggttatggcaacccatctgctggtggtggcggccaa
agctggtggtaa

DBGET integrated database retrieval system