KEGG   Botrytis cinerea: BCIN_05g00180Help
Entry
BCIN_05g00180     CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
bfu  Botrytis cinerea
Pathway
bfu03040  Spliceosome
bfu04141  Protein processing in endoplasmic reticulum
bfu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    BCIN_05g00180
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    BCIN_05g00180
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    BCIN_05g00180
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bfu01009]
    BCIN_05g00180
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bfu03041]
    BCIN_05g00180
   03009 Ribosome biogenesis [BR:bfu03009]
    BCIN_05g00180
   03110 Chaperones and folding catalysts [BR:bfu03110]
    BCIN_05g00180
   04131 Membrane trafficking [BR:bfu04131]
    BCIN_05g00180
   03051 Proteasome [BR:bfu03051]
    BCIN_05g00180
   03029 Mitochondrial biogenesis [BR:bfu03029]
    BCIN_05g00180
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bfu04147]
    BCIN_05g00180
Protein phosphatases and associated proteins [BR:bfu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     BCIN_05g00180
Spliceosome [BR:bfu03041]
 Complex B
  Other components
   Prp19 complex
    BCIN_05g00180
 Complex C
   Prp19-CDC5 complex
    BCIN_05g00180
Ribosome biogenesis [BR:bfu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    BCIN_05g00180
Chaperones and folding catalysts [BR:bfu03110]
 Heat shock proteins
  HSP70 / DNAK
   BCIN_05g00180
Membrane trafficking [BR:bfu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    BCIN_05g00180
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    BCIN_05g00180
Proteasome [BR:bfu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    BCIN_05g00180
Mitochondrial biogenesis [BR:bfu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    BCIN_05g00180
Exosome [BR:bfu04147]
 Exosomal proteins
  Proteins found in most exosomes
   BCIN_05g00180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Motif
Other DBs
NCBI-GeneID: 5430868
NCBI-ProteinID: XP_024548553
Position
5:join(83735..83777,83911..83961,84044..84170,84221..84263,84390..84512,84572..85462,85518..85531,86921..87473)
Genome map
AA seq 614 aa AA seqDB search
MADEVYEGAIGIDLGTTYSCVAVYEGTNVEIIANEQGSFTTPSFVSFTDKERLIGESAKN
NAAMNPKNTIFDIKRLIGRRFDDPHTTKDIQSWPFTVVDKDGSPFVQVEYLGEEKTFSPQ
EISSMVLTKMKEIAEVKLGKKVEKAVITVPAYFNDNQRQATKDAGAIAGLNVLRIINEPT
AAAIAYGLGAGKSNKERNVLIYDLGGGTFDVSLLNIQGGVFTVKATAGDTHLGGQDFDTN
LLDHFKKEFTRKTKKDLSNDPRALRRLRTACERAKRTLSNGASTNVEIDSLFDGEDFNAQ
ITRARFEDLNAKAFSGTLDPVAQVLKDANIDKSKVDEIVLVGGSTRIPKIQKLLSEFFDN
KKLEKSINPDEAVAYGAAVQAGILSGKATSAETADLLLLDVVPLSLGVAMEGNIFAPVVT
RGQTVPTIKKRTFTTVADNQQTVQFPVFQGERVNCEDNTSLGEFTLAPIPPMKAGDAVLE
VVFEVDVNGILKVTATEKTSGRSANITIANSVGKLSSSEIEKMVADAAEFKSSDDAFSKR
FESKQQLESYISRVEEIISDPTMSIKFKRGNKEKIESALSDAMAQLEIEDSTSDDLKKKE
LALKRAVTKAMSTR
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgaagtttacgagggtgccattggtatcgatcttggaaccacatactcttgt
gttgctgtatacgagggaaccaatgttgagatcattgccaacgagcaaggtagcttcacc
accccatctttcgtttccttcaccgacaaggagcgtttgatcggtgagtctgctaagaac
aatgccgccatgaacccaaagaacaccatctttgatatcaagcgtttgatcggaagaaga
ttcgatgacccccacaccacaaaggatattcaatcatggcctttcaccgttgttgacaag
gatggatccccattcgttcaagttgagtatctcggagaggagaagaccttctccccacaa
gagatctcatctatggttttgaccaagatgaaggaaatcgccgaggttaagttgggcaag
aaggtcgagaaggccgtcatcactgttccagcttacttcaacgacaaccaacgtcaggct
accaaggatgctggtgccatcgctggtcttaacgttctccgtatcatcaacgagcctact
gctgctgccatcgcttacggtctcggtgctggaaaatccaacaaggagcgtaacgttctc
atctacgatctcggtggtggaactttcgatgtttccctccttaacattcaaggtggtgtc
ttcactgtcaaggctactgccggtgacacccatttgggaggtcaagatttcgacaccaac
ctccttgatcacttcaagaaggagttcaccagaaagaccaagaaggacttgtctaacgac
ccccgtgctctccgtcgtctcagaactgcttgcgaacgtgctaagagaactctctccaac
ggtgcttccaccaacgttgagatcgattccttgttcgatggtgaggacttcaatgctcaa
atcacccgtgccagattcgaggacctcaacgccaaggccttctccggtactttggaccct
gttgcacaagttctcaaggatgccaacattgataagagcaaggttgacgaaatcgttctt
gtcggtggttctacccgtatcccaaagatccaaaagctcttgagcgagttctttgacaac
aagaagttggagaagagcatcaaccctgatgaggctgttgcttacggtgctgctgttcaa
gctggtatcctttccggaaaggctacctctgctgagactgctgacctcctccttttggat
gtcgtcccactttccctcggtgttgccatggagggtaacatctttgcccctgtcgttacc
agaggtcaaactgttccaactatcaagaagagaaccttcaccacagtagcagacaaccag
caaacagtccagttcccagttttccaaggagaacgtgtcaactgcgaagacaacacctcc
ctcggagagttcacccttgctcctattccaccaatgaaggctggtgatgcagttctcgag
gtcgttttcgaagtcgatgtcaacggtatcttgaaggtcactgctactgagaagacttcc
ggacgtagcgccaacatcaccatcgccaactccgtcggtaaactctcatcctccgagatc
gagaagatggttgcagatgcagctgagttcaagagcagtgatgacgctttcagcaagaga
ttcgagtccaagcaacaacttgagtcatacatttcaagagttgaggagatcatctccgac
ccaactatgtccatcaagttcaagcgtggcaacaaggagaagattgagtctgctttgagc
gatgctatggctcaactcgagattgaggattctacttctgatgacttgaagaagaaggaa
cttgctttgaagagagctgtcaccaaggccatgtccactcgttaa

DBGET integrated database retrieval system