KEGG   Botrytis cinerea: BCIN_06g06690Help
Entry
BCIN_06g06690     CDS       T01072                                 

Gene name
Bcytm1
Definition
(RefSeq) Bcytm1
  KO
K14863  ribosome biogenesis protein
Organism
bfu  Botrytis cinerea
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bfu03009]
    BCIN_06g06690 (Bcytm1)
Ribosome biogenesis [BR:bfu03009]
 Eukaryotic Type
  Pre-60S particles
   Other pre-60S particles
    BCIN_06g06690 (Bcytm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 NLE Nup160 Colicin_Ia
Motif
Other DBs
NCBI-GeneID: 5435746
NCBI-ProteinID: XP_001555182
UniProt: A6S0T8 A0A384JL87
Position
6:join(2340769..2340859,2340923..2342268)
Genome map
AA seq 478 aa AA seqDB search
MAQGQVQVHFSTTSPDIELPEGKQQLLVPTNVRRYGLSQILNSEAMLDTSSPIPFDFLIN
GTFLRTTLDEYLTANGLSSETTLNLQYVRSLIPPLYEASFEHDDWVSSVDVLSGSSAAGA
WGKNSIVEGQERILSGSYDGLLRVWNKSGQAIATSAPASIGGHTSGVKAAKWLSARQVAS
AGLDRTIRIWNYSESEDHFSAQLKPTMELYGHTGSIDSIAVHGPSNRILSASADGQIGFW
TSHKSSAPEVNTSLISGPSTKRRKITTSTSTPQRGPLSLMDCHNGPATAVIFNPQDPTVA
YSASQDHTIKTLDITTSSIVDTRTLLNPILSLSALPGIGHQIIAAGTTARHIALIDPRAS
AATTQAMTLRGHTNFVSSIFADPDSNYGLVSAGHDGTCRVWDLRSTRQGTKDEGLGVVGE
AVYIIERESRKDKTTKTVGGEGVKVFDVNWDKDVGIVSAGEDKMVQVNRGRGVTRPEN
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaggacaggttcaagtgcatttcagcaccacatctccagatatcgaattacct
gaaggaaaacaacaattgctcgttcctaccaatgtacgaagatatggactttcacagatt
ctcaattccgaggcgatgctcgatacctcttcgccgataccattcgatttcctgattaac
ggtacattcttgcgaacgaccctcgatgaatatctcactgcaaatgggttatcctccgaa
acaacgttaaacttacaatatgttcgaagtttgatacctcctctttatgaagcaagtttc
gagcatgatgattgggttagcagtgttgatgttttgtctgggagctctgctgcaggagct
tggggtaaaaattcaattgttgaagggcaggagcgtatattgtcaggttcttatgatgga
ctcctcagagtttggaacaaatcaggtcaggctattgcaacatctgcgcctgccagtatt
ggtgggcatacctctggagtaaaggctgcgaaatggctctcggccagacaagttgcatcg
gcaggtttggatcgcacaataaggatatggaattattctgaatcagaggatcatttctcg
gcgcaattgaaaccaaccatggagttatatggccataccggtagcattgactcaatcgca
gttcatggaccatcgaatcgcattttatctgcttcagcagatggacaaattggtttctgg
acttcacataaatcctcagcacccgaagtaaatactagtcttatttctggaccatctaca
aaacgacgcaagatcacaacctccacatccactcctcagcgtggccctctatctctcatg
gattgtcacaatggacctgcgactgctgttatcttcaacccccaggatcctactgttgca
tattctgcttcccaagatcataccatcaaaacactcgatatcaccacttccagtattgtc
gacacaagaactttattgaacccaatcctctcattaagcgccctaccaggaatcggtcat
caaataatagcagcaggtacaacagcacgtcatatcgctctcattgatcctagagcttcg
gctgctacaacacaagccatgacacttcgtggacacaccaacttcgtttcatcaatattt
gcagatcctgatagcaactatggattagtatcagctggtcacgatggaacctgtagggta
tgggatcttagaagcacaagacagggaacgaaagatgaaggacttggtgttgttggagag
gcagtttatatcattgagagagagagtaggaaagataagacaactaagacagttggtggt
gagggagttaaggttttcgatgttaactgggataaggatgttggaattgttagtgctggt
gaagataaaatggttcaagtgaataggggaagaggtgttacaagacccgagaattag

DBGET integrated database retrieval system