KEGG   Botrytis cinerea: BCIN_08g03520Help
Entry
BCIN_08g03520     CDS       T01072                                 

Gene name
Bcpho8
Definition
(RefSeq) Bcpho8
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
bfu  Botrytis cinerea
Pathway
bfu00730  Thiamine metabolism
bfu00790  Folate biosynthesis
bfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BCIN_08g03520 (Bcpho8)
   00790 Folate biosynthesis
    BCIN_08g03520 (Bcpho8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bfu04147]
    BCIN_08g03520 (Bcpho8)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bfu00537]
    BCIN_08g03520 (Bcpho8)
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BCIN_08g03520 (Bcpho8)
Exosome [BR:bfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCIN_08g03520 (Bcpho8)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bfu00537]
 Enzymes
  BCIN_08g03520 (Bcpho8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme RskA Phosphodiest
Motif
Other DBs
NCBI-GeneID: 5435163
NCBI-ProteinID: XP_001554614
UniProt: A0A384JQR7
Position
8:complement(join(1353495..1354027,1354081..1354216,1354272..1354771,1354825..1355380))
Genome map
AA seq 574 aa AA seqDB search
MAPNKNSPLFASGRPSSSNSEERAAAEDDALLGNRPKNSYEAKRPGFWREIGLFTWAVVA
TAAVIVLGVLLSQSQQAPQKTKQNGKRNLIFMVSDGMGPASLSLTRSFRQFEGDLPINDI
LQLDQHFIGSSRTRSSSSLVTDSAAGATAFSCGRKSYNGAISMLPDHTPCGTVLEAAKRA
GYITGLVVTTDITDATPACFASHVDYRMQEDSIALQEVGEHPLGHRVVDLMLGGGRCHFL
PNTSESSCRADSRDVTKLAQDKYGWTYIDTREDFDKLKLGKKVQLPLLGLFSDTDIPFEL
DRRNMNDVYPSLDEMARTALTALEAAAKDSDKGFFLMIEGSRIDHAGHGNDPAAQVHEVL
AYDRAFQSVIDFLDKSDTEGALVATSDHETGGLAVARQLNPSYPQYLWYPEVLSNASHSS
EYLSRVLRAHVASEEAVTKGRPVSRRFVKEDLVKKGLGIMDATEEEIDRILDNPALSAYA
FADIISRRAQIGWSTHGHSAVDVNIYGYGADVLRGNHENIEVGKFLRDYLNVDVDAITAE
LNSKTNGQSLSAASTPDVPDFGRYEERLKKNLPQ
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgaataaaaacagtccgctgttcgcgtcaggaagaccctcttcttctaattcc
gaagaaagagctgcggcagaggacgatgcgcttcttggtaatcgaccaaagaattcctac
gaagccaagagacctggattctggcgagagattgggctcttcacctgggctgttgttgcc
actgctgctgtcatcgtcctaggcgttttattgtcgcaaagccaacaagctccgcagaag
acaaagcaaaatgggaagcgcaatcttattttcatggtgagcgatggaatgggcccggca
tctttgagtttgacgagaagcttccgacaatttgaaggagatctaccgatcaatgatatt
cttcaactggatcaacattttatcggttcgtcgcgcacgagatcaagcagcagtcttgtc
acagatagtgcggcgggagctactgcattcagttgcggaagaaaaagctataatggcgca
atttctatgttgcctgatcacaccccttgtggcactgtacttgaagctgcgaaaagagcc
ggttatatcacgggcttggttgttacaacagacataacggatgcgaccccagcttgcttt
gcctcacacgttgattaccgaatgcaggaggactcgatagctttacaggaggttggagaa
catcctctcggacatcgagttgttgatttgatgttaggcggtggacggtgtcactttttg
cccaatacatcagaatctagttgcagagctgatagtcgcgatgtcacaaaactggcgcaa
gacaaatatgggtggacatacattgataccagagaggattttgacaaattgaagcttgga
aagaaggttcagctgccattgttgggtctcttttctgatacagacattcctttcgagctt
gatcgacgaaacatgaatgatgtctatccttcccttgatgaaatggcaagaacagctttg
accgcactcgaagctgcagccaaagatagtgataagggcttctttctcatgattgagggt
agtcgaatcgatcatgccggtcatggaaacgatccagctgcccaagtccacgaagtactt
gcctatgatcgagctttccaaagtgtaattgatttcctagacaagagcgatactgaaggt
gctcttgttgctacaagtgaccacgaaactggaggcttagctgttgcaagacaacttaac
ccttcataccctcaatatttatggtaccctgaggtgttgtcaaatgcttcccattcatca
gagtatctttctagggttctaagggctcatgttgcttcagaagaagcagttaccaaagga
cgccccgtcagcaggcgattcgtgaaagaagatctcgtcaaaaagggtctcgggatcatg
gacgcgactgaggaagagattgatcgcatacttgacaatccggcgctttctgcttatgct
tttgccgatatcattagccgtagagcacagatcggctggtcaacccacggccactctgct
gttgatgtcaacatctatggctatggtgctgatgttcttcgtggaaaccacgaaaatatc
gaagtcggcaaatttttgagagattatctcaatgttgacgttgatgcaatcacagcagaa
ctaaacagcaagactaatggtcaaagtctctcagcagcttcaacccccgatgttccagat
tttggacgatacgaggaaaggctcaagaagaacttgccacaatag

DBGET integrated database retrieval system