KEGG   Botrytis cinerea: BCIN_08g07060Help
Entry
BCIN_08g07060     CDS       T01072                                 

Definition
(RefSeq) Bcgpi16
  KO
K05292  GPI-anchor transamidase subunit T
Organism
bfu  Botrytis cinerea
Pathway
bfu00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
bfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    BCIN_08g07060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 5430150
NCBI-ProteinID: XP_024550616
Position
8:complement(join(2589089..2590077,2590126..2590529,2590577..2590959))
Genome map
AA seq 591 aa AA seqDB search
MALNAMNPMNKFYHIFFLLFSLLSTGVVASSDYHEQLLLRPLHPSSLLASFNFQSNTSLE
SFEQQNFRYFPRSLGQILQYANTRELHLRFSLGRWDAENWGARPWGGTREGGTGVELWAW
VEAATDEEADGRWLTLTNALSGLFCASLNFIDSTRTTRPVLSFQPVNDHSDSTLANLHLL
HGTLPREVVCTENLTPFLKLLPCKGKAGISSLLDGHKLFDASWQSMSIDVQPICASDSSD
CQLQITQTIDMVLDIQRSRRPRDNPIPRPVPFEDLKCDTSKSYHAEDTCFPLDNAAEEED
WSLSQIFGHSMKGSCPLADDVEDSVCINVPHARNVFTSGGAVEHKDPSGYSRCFRIPQDS
DFEMVLPRQDIHEKAPLEQPLLYAERSFIGYGQERGGVQAILTNPSPTNAVDFVYMESLP
WFMKVYLHTLKADTNGLYEDVIQEMFYRPALDRKRGTQLEVRMRIPADSTVILTYDFEKA
ILRYTEYPPDANRGFDIAPAVITIGNVSIRTTSLLLPLPTPDFSMPYNVIILTSTVMALA
FGSVFNLLVRRFVAADEAENWDIKAVRMRVLMAVQKTLARITGKAKFGKGE
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggctttgaatgccatgaatccgatgaataaattttaccatattttcttccttttattt
agtttgttatctacaggagtagtcgcatcctcagattatcacgagcaacttcttttacga
ccccttcatccttcatcgttactcgcttcattcaactttcaaagtaacacaagcctcgaa
tcattcgaacaacagaattttcgctattttccaagatcattggggcaaattcttcagtat
gccaatacccgagaattacatttgaggttcagccttggtagatgggatgccgaaaattgg
ggtgcaaggccatggggaggtacgagggaaggtggaacaggtgtagagctttgggcttgg
gtagaagctgccactgatgaggaggctgatggtcgctggctaaccttgaccaacgcattg
tctggccttttctgtgcttcccttaacttcatcgattccacaagaacaacgagacctgtc
ttatcatttcaaccagtcaatgatcactcagactccacattagcgaacctacacttactg
catggaactctaccacgagaagtcgtctgcacagaaaatctgacgcctttcttgaaactc
ctgccctgtaaaggcaaggccggtatttcgagcttacttgatggacataagctatttgat
gcttcatggcagagcatgtcaattgatgtgcaacctatatgcgcaagtgattcgagtgac
tgccagcttcagatcacacaaactattgacatggtattagatatccaaagatccaggcgt
ccaagagacaatccaattccacggcccgtaccatttgaagatttgaaatgcgatacatct
aaatcataccatgccgaggatacttgcttccctctagataacgccgcggaagaagaggat
tggagtctatcacaaatttttggtcattcgatgaagggatcttgtccactagctgatgat
gttgaagattccgtttgcataaatgttcctcatgcccgcaatgtctttacttctggagga
gcagttgagcacaaagatccctctggatacagccgatgttttcgaataccacaagacagc
gatttcgagatggtattacctcgacaagacattcacgaaaaagccccattggagcaaccc
ctactttatgccgaacgctcatttattggatatgggcaggaacgaggtggtgtacaagcc
atactcacaaatccttcgccaacgaatgcagttgattttgtatacatggagtcgctccct
tggttcatgaaggtatatcttcataccttaaaggccgatactaacggcttgtatgaagat
gtcatacaagagatgttctatcgtccagccttggatcgcaagagagggactcaattggaa
gtgcggatgcgcattccagcagattctacagtcattttgacctatgactttgaaaaggcc
atccttcgatatacagagtatcctcctgacgcgaaccgtggatttgatattgctccggcc
gttatcaccattggaaatgttagcattcgaaccacgagtctcttgcttccacttccaaca
ccggatttcagcatgccttacaatgttattattcttaccagtactgtaatggccttggca
tttggaagcgttttcaatcttctagtcaggagatttgttgcagcggatgaagctgaaaat
tgggacatcaaggctgttaggatgcgggttttaatggctgtgcaaaagaccctggctcgg
ataacgggaaaagcgaagtttggcaagggagaatag

DBGET integrated database retrieval system