KEGG   Botrytis cinerea: BCIN_10g01530Help
Entry
BCIN_10g01530     CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
bfu  Botrytis cinerea
Pathway
bfu00020  Citrate cycle (TCA cycle)
bfu00640  Propanoate metabolism
bfu01100  Metabolic pathways
bfu01110  Biosynthesis of secondary metabolites
bfu01130  Biosynthesis of antibiotics
bfu01200  Carbon metabolism
Module
bfu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bfu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCIN_10g01530
   00640 Propanoate metabolism
    BCIN_10g01530
Enzymes [BR:bfu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     BCIN_10g01530
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BCIN_10g01530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 5436289
NCBI-ProteinID: XP_001555700
UniProt: A0A384JUA4
Position
10:join(583011..583171,583233..583261,583316..583442,583516..583578,583635..583660,583709..584152,584204..584343)
Genome map
AA seq 329 aa AA seqDB search
MQAFSRCARPAMQAAMRRQGYSTSTSAYAATAENLRITKDTRVIYQGFTGKQGTFHAQQA
IEYGTTVVGGTNPKKAGQTHLDLPVFATVEQAVKEAGATASAIFVPPPLAAAGIEEAIAA
EIPLVVCITEGIPQHDMVRITDILKTQGKTRLVGPNCPGLIAPGQCKIGIMPGFIHKRGR
IGIVSRSGTLTYEAVNQTTQAGLGQSLVVGIGGDPFSGTNFIDCLKVFLEDEETDGIIMI
GEIGGSAEEDAAEFLKDYNTAKKPVVSFIAGISAPPGRRMGHAGAIVSGGKGGADSKISA
LEAAGVIVERSPALLGKTLHAEFMRLDMI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctttttcaagatgtgccagacctgcgatgcaggctgctatgagaagacaaggc
tattccacttcgacctctgcttatgctgctaccgcggaaaaccttcgtatcactaaggat
accagagttatctaccaaggtttcactggtaaacaaggaactttccatgcccaacaagcc
atcgaatatggtacaactgttgttggaggtacaaacccaaagaaagctggacaaactcat
ctcgatttacccgttttcgcaaccgtcgaacaagctgtaaaggaagccggtgctacagct
tctgctatcttcgtcccaccccctcttgctgctgccggtattgaggaggctatcgctgct
gaaattcctttggttgtgtgtatcactgagggtatcccacaacatgacatggttcgcatt
acagatattttgaagactcaaggaaagacacgtttggttggacccaattgcccaggtctc
attgcgccaggacaatgtaagattggtatcatgccagggttcattcacaagcgtggacgt
attggtattgtttctcgttcaggaactttgacttatgaggctgtcaaccaaactacacaa
gctggattgggtcaatctcttgttgttggtattggtggtgatccattctctggaaccaac
ttcattgattgcttgaaggtattcctcgaggatgaggagactgatggtatcatcatgatt
ggagaaatcggaggatccgcagaagaagatgctgccgaattcttgaaggattacaacact
gctaagaagccagttgtcagctttatcgctggtatctctgctcctcctggacgaagaatg
ggacacgctggtgctattgtcagtggcggaaagggtggtgctgattccaagatctcagcc
cttgaagctgcaggtgttatcgtggagagaagtccagcattgctcggaaagactttacat
gctgagttcatgagacttgacatgatttaa

DBGET integrated database retrieval system