KEGG   Botrytis cinerea: BCIN_10g05280
Entry
BCIN_10g05280     CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
bfu  Botrytis cinerea
Pathway
bfu00100  Steroid biosynthesis
bfu01100  Metabolic pathways
bfu01110  Biosynthesis of secondary metabolites
Module
bfu_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    BCIN_10g05280
Enzymes [BR:bfu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     BCIN_10g05280
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 5427293
NCBI-ProteinID: XP_024551473
Position
10:complement(join(1997575..1998695,1998751..1999055,1999114..1999184))
AA seq 498 aa
MAPKKTASTVSKAAEPHGYEFGGPLGAFGISFGLPLLCYATTFLCNDISGCPVPSSLSPS
TLTIDNLKQEVGWPANGLAGLLSWDVFLKVMGYYFLSMVLHRVLPGEEKLGVELASGGKL
KYKFNTWSSTMFTFALCAAGTIAQGADFPVWTFIYDNYLQILTANIIISYGLATFVYIRS
FSVKPGNSELRELAAGGHSGNMLYDWFIGRELNPRVTLPLLGEIDIKEFCELRPGLMGWL
LMDYAFVAHQYKTYGYITDSITLITAFQTLYVLDSYWMENAILTTMDITTDGFGLMLSFG
DLVWVPFVYSLQARYLAVYPLSLGVFGTSGVLAVLATGYYIFRGANNEKNRFRTDPTDPR
VAHLKYLETKSGSKLLISGWWGVARHINYAGDWIMAWSYCLPTGIAGYLINHSSVAPTSG
QSLADGSFVYSGPAVHTEVTQGAARGWGMIITYFYVVYFGVLLVHREMRDEEKCERKYGE
DWKRYKEIVRYRIIPGIY
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggctcctaagaagactgcgagtacagtctcgaaagcagctgagcctcatggatatgaa
tttggcggaccactgggagctttcggtatatctttcggactaccccttctttgctacgcc
acgacctttctctgcaatgacatttctggttgtccagttccctcttcgctctctccttcg
acgcttacgatcgacaatcttaaacaagaggttggatggcccgcaaatggactcgcgggc
ttgttaagctgggatgtgtttctcaaagtaatgggctactactttctgagcatggtttta
cacagagttttgccaggtgaagagaagttaggtgtcgaactcgcaagtggtggaaagctc
aagtacaaattcaatacttggtcttctacaatgtttacatttgctctatgcgccgcagga
actattgcccaaggagcagacttcccagtctggactttcatctacgacaattacctacaa
atacttaccgcaaacatcatcatctcctacggtctcgcaacttttgtctacatccgcagt
ttcagtgttaagcccggtaactctgaactgcgcgagttggctgctggcggtcattctggg
aatatgctatatgattggtttattggacgagaactcaatccaagagtgactctcccgtta
cttggcgaaattgacattaaagaattctgtgagctacgaccaggtctcatgggatggctt
ctgatggattatgcatttgtcgctcaccaatacaagacttacggatatatcaccgacagt
atcacgttgattacagcatttcaaacactatacgtgcttgattcatactggatggaaaat
gctatcctcactaccatggacattaccacggatggcttcggactcatgttatcatttgga
gacttagtctgggttccatttgtttattctcttcaagctcgttaccttgccgtctaccca
ctttccctcggcgtatttggcaccagcggcgttctagcagttttagctacaggatattat
attttccgtggcgccaataacgaaaagaaccgcttcagaactgacccaacagaccctcgt
gtcgcacatctcaagtacctcgagacaaaatccggctccaaacttctcatttccggctgg
tggggtgtagctcgtcatattaactatgctggtgattggatcatggcttggtcttattgt
cttcctactggtattgctggttatttaatcaaccacagctcagtggcccccacatcaggt
caatccctcgcagatggatctttcgtgtacagtggaccagcagtacatacagaagtcacg
caaggtgcagctaggggctggggtatgatcatcacatatttctatgtggtttactttgga
gtcctgttggtgcatagagaaatgagagacgaggagaagtgtgagagaaagtatggcgag
gactggaagagatacaaggagattgttagatacagaatcattccaggtatctattag

DBGET integrated database retrieval system