KEGG   Botrytis cinerea: BCIN_11g02340Help
Entry
BCIN_11g02340     CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
bfu  Botrytis cinerea
Pathway
bfu00600  Sphingolipid metabolism
bfu01100  Metabolic pathways
Module
bfu_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    BCIN_11g02340
Enzymes [BR:bfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     BCIN_11g02340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 5430923
NCBI-ProteinID: XP_024551695
Position
11:join(789586..789742,789806..789862,789918..790936,791076..791408)
Genome map
AA seq 521 aa AA seqDB search
MASSMDSNHPFIDTMGITSDEYVREQAFVTDGTLTVGRNASLTLGTDSLIVLDEAFEKES
ATCCGFWTFASSSANTRPIPFYNVLWAEISDTKELAIRYAAPTSKTRVQATELKYAIESN
STEEVEKWIAKLLDRSYGESQQTKRAKVLVNPHSGKGKAQKYYDRDVEPLLKAANCSIDM
VKTKFQGDAVTIVEDMDVEAYDMVVCCSGDGLAHEVFNGLGKRHDAKKALSKIAVTHVPC
GSGNAMSMNLNGTASASLATLAIIKGIPTPLDLMSITQGETRTISFLSQSVGIVAEADLA
TEHLRWMGSARFTYGFLERLIGQAIYPCDIAVKVAIEDKPSIKDYYRKEMSNREPASERR
GYKHLLDDDASASSGTDDGLPPLRYGTVSDKLPEGWEMVPYDKLGNFYCGNMAYMASDAN
FFSAALPSDGYMDLVCINGDISRLSAIKMMLSVESGKLFDIPDVWYRKILGYRIIPKQKG
DGYISIDGERVPFQPFQAEVHKGLGTVLSKTGHMYEWHGPI
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttctatggattcaaatcatccgtttatcgatacgatgggaattactagtgac
gaatatgtgcgggaacaggcgtttgtgactgatgggacgttgacggtaggaaggaatgct
tccttgaccttgggaacggactctttgatcgtgcttgatgaggcttttgaaaaggagagc
gcaacttgttgtggattttggacttttgcttcaagttccgcgaatactagaccgatccct
ttttacaacgtcctctgggctgagatatcagacacgaaagagcttgcgattcgatatgct
gcacctacatcaaaaacgagggtacaggccacggagttgaaatatgcgattgaatcaaat
tctacggaagaagtcgagaaatggatagcaaaattactagatcgatcgtacggcgaatcg
caacaaacaaaacgagcaaaggtcctggtgaaccctcatagtggcaaaggaaaggcgcag
aaatactatgatcgggatgtggaaccccttctgaaggcagcgaattgtagtatcgacatg
gtaaagacgaaatttcagggagatgcggttacgattgtcgaggatatggatgtcgaagct
tatgacatggtggtttgctgttccggagatggattagcgcatgaggtgtttaacggcctg
ggaaagagacatgatgcgaaaaaagccctatcgaagattgcagtgacgcatgtaccatgc
gggagtggaaatgctatgagtatgaatttgaacggaactgccagtgcgagtttggctact
ttggctatcatcaaggggattcccacgccgctggatcttatgtcgatcacacaaggagaa
acacgaacaattagtttcctatctcagtctgtagggattgtggccgaggctgatttagct
accgaacatttgagatggatgggaagtgcacgatttacgtatggatttctagagagactt
attggacaagcaatttatccttgtgatattgctgtcaaggttgcgatagaagataaacca
agtataaaagattattatagaaaggagatgagcaatcgcgaaccggcaagcgagaggaga
ggatacaaacacctattagacgatgatgcttcggccagtagtgggacggatgatggattg
cctccgctgagatatggtactgtaagcgacaaattaccggagggctgggaaatggttccc
tacgataaattgggcaatttctactgtggaaatatggcatacatggcctcagatgccaat
ttcttctccgccgcccttccaagtgacggttacatggacctcgtttgcatcaacggcgat
ataagtcgtctttcagctatcaagatgatgttgtccgtagagagtgggaaactgtttgac
attcctgatgtatggtatcgtaagatcctaggatatagaatcattccaaaacagaaaggg
gatggatacattagcattgatggggagagggttccttttcaaccatttcaagccgaggta
cataagggattgggtacggtactctcgaaaacaggacatatgtatgagtggcatggtcct
atttaa

DBGET integrated database retrieval system