KEGG   Botrytis cinerea: BCIN_14g01700Help
Entry
BCIN_14g01700     CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
bfu  Botrytis cinerea
Pathway
bfu00500  Starch and sucrose metabolism
bfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BCIN_14g01700
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     BCIN_14g01700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6 CBM_1
Motif
Other DBs
NCBI-GeneID: 5433349
NCBI-ProteinID: XP_001552807
UniProt: A0A384K2B9
Position
14:complement(join(736899..737036,737105..737253,737305..737700,737756..738009,738061..738418,738471..738549))
Genome map
AA seq 457 aa AA seqDB search
MGFKNALLAAAAVAPTVYAQGAAYAQCGGQGWSGATTCVSGYTCVVNNAYYSQCLPGSAV
TTTATTAPTATTPTTIITSTTKATTTTGGSSATTTAAVAGNPFSGKALYANPYYASEISA
SAIPSLTGAMATKAAAVAKVPTFYWLDTAAKVPLMGTYLANIRALNKAGANPPVAGTFVV
YDLPDRDCAAAASNGEYSIADGGLVKYKAYIDSIVALLKTYSDVSVILVIEPDSLANLVT
NLSVAKCSNAQAAYLEGTEYAIAQLNLPNVAMYLDAGHAGWLGWPANIGPAAQLFGQIYK
AAGSPAAVRGLATNVANYNAWTSTTCPSYTSGDSNCNEKLYINALAPLLTAQGFPAHFIM
DTSRNGVQPTAQQAWGDWCNLIGTGFGVRPTTNTGDALEDAFVWIKPGGEGDGTSDTTAA
RYDFHCGLADALKPAPEAGTWFQAYFAQLLTNANPSF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgggttttaagaatgctctcctcgctgccgcggctgtagcacctactgtttatgcacag
ggtgcagcttacgcacaatgtggtggtcaaggttggagtggcgcaacaacttgtgtttcg
ggatatacctgtgttgtcaacaatgcatactattctcaatgtttacccggctctgcggtc
acgactacagcaacgacagcccccaccgcaacgactcccacaacaatcatcacttctacc
accaaagctaccacgaccacaggtggtagcagtgcaacgacaacagcagcagttgctggt
aatccattctcaggaaaagcactttatgcgaatccatactatgcttcggaaatctctgcc
agtgctatcccttcactcactggagccatggccactaaagctgctgcggtagcaaaggtt
ccaactttctattggcttgacaccgcagccaaagttccattgatgggaacttaccttgcc
aacattcgggccttgaacaaagcaggagcaaatccacctgttgctggtactttcgtagtc
tatgatttgccagacagagattgtgcagctgcagcttccaacggagaatacagcattgca
gacggtggtctcgtaaaatacaaagcttacatcgattccatcgtcgctcttttgaaaact
tactctgatgttagcgttattctcgtcattgaacccgattcgttggccaatctagtcacc
aacttgtccgtcgcaaaatgttccaacgcccaagcagcctatctagaaggtaccgaatat
gccatcgcgcaattgaatcttccaaacgtcgctatgtacttggatgctggacacgctggt
tggttaggatggcctgcaaatatcggaccagctgcacagctcttcggccaaatctacaaa
gcagctggaagcccagctgcagtcagaggtcttgcaactaatgttgcaaactacaatgct
tggactagcaccacttgcccgtcctacacctctggcgattccaactgtaacgagaaattg
tacatcaacgctcttgctccgcttttgaccgctcaaggtttcccagctcacttcatcatg
gatactagtcgcaatggtgttcaaccaaccgcacaacaagcctggggagactggtgcaat
ctcatcggcaccggattcggtgttcgaccaaccacaaacacaggagatgcattggaagac
gcatttgtctggatcaagcccggtggagaaggcgacggcacttcggacaccaccgctgcg
cgatacgatttccactgcggactcgcagatgcgctcaagccagctccagaagcgggtact
tggttccaagcttactttgcccaattactcaccaatgccaatcccagcttttaa

DBGET integrated database retrieval system