KEGG   Brevibacterium flavum ZL-1: C628_02965Help
Entry
C628_02965        CDS       T04445                                 

Definition
(GenBank) succinate CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
bfv  Brevibacterium flavum ZL-1
Pathway
bfv00020  Citrate cycle (TCA cycle)
bfv00620  Pyruvate metabolism
bfv00650  Butanoate metabolism
bfv01100  Metabolic pathways
bfv01110  Biosynthesis of secondary metabolites
bfv01120  Microbial metabolism in diverse environments
bfv01130  Biosynthesis of antibiotics
bfv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bfv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C628_02965
   00620 Pyruvate metabolism
    C628_02965
   00650 Butanoate metabolism
    C628_02965
Enzymes [BR:bfv01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     C628_02965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hydro CoA_trans
Motif
Other DBs
NCBI-ProteinID: ANR61579
Position
644170..645048
Genome map
AA seq 292 aa AA seqDB search
MSERVQNRELKAKIMSAEEAAQFINNGATVGMSGFTGAAYPKALPTAIANRAKQEHAAGR
EYGIRMLTGASTAPDCDGVLAEADALSFRMPYQSDPAMRGKINAGQLNYQDIHLSHSGLQ
VEQGFFGAIDIAIVEVARITKEGHLIPSSGVGNNVEYLDAAQHIILEVNSWQSLDLEGMA
DIYRVPHLPHRTPIPIEKVGDRVGTTFIDIDIAKVIAVVETDAPDRNSPFKPFDEVSKQI
AGNYLDFLEGEVAGGRLVYDHYIMQSGVGNVPNAVMAGLLDWLSPPVRHHSR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaagagtgcaaaaccgcgaactcaaggcaaaaataatgtcggcggaggaagcg
gcccaatttatcaacaacggcgccacggtgggaatgtccggtttcaccggggcggcttac
cccaaagctttgcccacggctatcgccaatcgcgccaaacaggaacatgcagccggccgt
gaatatggcatcagaatgctcaccggtgcatccacggcaccggattgtgatggcgtgctt
gctgaagccgatgcgttgagcttccgcatgccttatcaatcagatcctgcgatgcgtggg
aaaatcaacgcggggcagctgaactaccaagacattcacctttcgcattcaggcctgcag
gttgaacaaggattctttggtgccattgacattgcaatcgttgaggttgcgcgcattaca
aaagagggccatctgattccttcctcgggtgtgggaaataacgtggagtatcttgatgca
gcacaacacatcattcttgaggtcaattcctggcaatccctcgatcttgaaggcatggcc
gatatctaccgtgttccacatttgcctcaccgcacgccgatcccgattgaaaaagttggc
gatcgcgtgggcacgactttcatagatattgatatagccaaggttattgctgtcgtggaa
accgatgccccagaccgcaacagtccattcaagcctttcgatgaagtgtccaaacaaatc
gcaggaaactacctggacttcctcgagggggaggtggctggcgggcgtcttgtttacgat
cactacatcatgcaatccggtgttggaaatgtccctaatgcagtcatggcgggtttgctg
gattggctttccccgccagttcgccatcactcacgatga

DBGET integrated database retrieval system