KEGG   Brevibacterium flavum ZL-1: C628_11590Help
Entry
C628_11590        CDS       T04445                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bfv  Brevibacterium flavum ZL-1
Pathway
bfv00071  Fatty acid degradation
bfv00072  Synthesis and degradation of ketone bodies
bfv00280  Valine, leucine and isoleucine degradation
bfv00310  Lysine degradation
bfv00362  Benzoate degradation
bfv00380  Tryptophan metabolism
bfv00620  Pyruvate metabolism
bfv00630  Glyoxylate and dicarboxylate metabolism
bfv00640  Propanoate metabolism
bfv00650  Butanoate metabolism
bfv00900  Terpenoid backbone biosynthesis
bfv01100  Metabolic pathways
bfv01110  Biosynthesis of secondary metabolites
bfv01120  Microbial metabolism in diverse environments
bfv01130  Biosynthesis of antibiotics
bfv01200  Carbon metabolism
bfv01212  Fatty acid metabolism
bfv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bfv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C628_11590
   00630 Glyoxylate and dicarboxylate metabolism
    C628_11590
   00640 Propanoate metabolism
    C628_11590
   00650 Butanoate metabolism
    C628_11590
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C628_11590
   00072 Synthesis and degradation of ketone bodies
    C628_11590
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C628_11590
   00310 Lysine degradation
    C628_11590
   00380 Tryptophan metabolism
    C628_11590
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    C628_11590
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C628_11590
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C628_11590
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bfv04147]
    C628_11590
Enzymes [BR:bfv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     C628_11590
Exosome [BR:bfv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C628_11590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANR63236
Position
2489709..2490935
Genome map
AA seq 408 aa AA seqDB search
MNPQDIVICSPLRTPVGAYGGSFTGVPVEELATTVINAIVEATGITGDDVDDLILGQASP
NGAAPALGRVVALDSKLGQNVPGMQLDRRCDSGLQAIVTAAAHVASGAADLIVAGGAESM
SRVEYTVSGDIRWGVKGGDMQLRDRLAEARETAGGRNHPIPGGMIETAENLRREYGISRE
EQDKISAASQQRWGKAADAGLFDDEIVPVTVPAKKRGQEPTIVSRDEHGRPGTTVEKLAA
LRPIMGRQDAEATVTAGNASGQNDGAAAVIVTTRAKAEEKGLRPVMRLAGWSVAAVPPET
MGIGPVPATKKVLDRLGLTLEDIGAIELNEAFAAQALSVLKEWNISWEDERVNPLGSGIS
MGHPVGATGARMAVTLAHRMQRENTQYGLATMCIGGGQGLAAVFEKEN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctcaagatattgtcatctgttccccattgcgcaccccagttggtgcttacggc
ggatccttcaccggcgtccctgttgaagaattggccaccaccgtgatcaacgcgatcgtt
gaggcaaccggcatcaccggcgacgatgtggacgatctgatcctcggccaggcatccccc
aacggtgcggctccagcactgggccgtgtggttgccttggattccaaacttggccaaaac
gttccaggcatgcagcttgatcgccgctgtgattccggcctgcaggcaattgtcaccgct
gctgcgcacgttgcatccggtgctgctgatctgatcgtcgcaggtggcgcggaatccatg
agccgcgttgagtacaccgtgtccggcgatatccgttggggtgtcaagggcggcgacatg
cagcttcgtgaccgccttgcagaagcacgcgaaaccgctggcggacgcaaccacccgatc
cccggtggcatgatcgagaccgctgagaacctgcgtcgcgaatacggcatctcccgcgag
gagcaggacaagatctccgcagcatcccagcagcgttggggcaaggctgctgatgcgggg
cttttcgacgacgagatcgtgccagtcaccgtccctgccaagaagcgcggccaggagcca
accatcgtttctcgtgacgagcatggtcgaccaggaacaaccgtcgaaaagcttgctgct
ttgcgccccatcatgggccgccaggatgcggaagcaaccgtcaccgctggcaacgcgtcc
ggccaaaatgatggcgctgctgccgtcatcgtgaccactcgcgccaaggccgaggagaag
ggcctgcgcccagtcatgcgtttggctggctggtctgtggctgctgttcccccagagacc
atgggtattggacctgttcctgccaccaagaaggtcctggatcgtttgggccttaccctg
gaggacatcggcgcgatcgaactcaacgaagctttcgcagctcaggcactgtctgtgctc
aaggaatggaacatttcttgggaagatgagcgcgtcaacccactgggttccggtatttcc
atgggacacccagtcggtgccaccggtgctcgcatggcagtaaccttggctcaccgcatg
cagcgtgaaaacactcagtacggactggccaccatgtgcatcggtggcggccaggggctt
gcagctgtctttgaaaaggagaactaa

DBGET integrated database retrieval system