KEGG   Blastomonas fulva: B5J99_01595Help
Entry
B5J99_01595       CDS       T05612                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
bfw  Blastomonas fulva
Brite
KEGG Orthology (KO) [BR:bfw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    B5J99_01595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ASR50320
UniProt: A0A222WUR3
Position
complement(336311..336709)
Genome map
AA seq 132 aa AA seqDB search
MDRFFTHSATTHGITVRVAVSFLPDRSRADSARWFWSYHIRIENHSDSAVQLLTRHWVIT
DGRGGVHQVDGEGVVGEQPVILPGKSHDYVSGCPLTTPTGRMEGVYRMMRDDDELIAVEI
PRFPLVAPAVAD
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggacaggttcttcacccactctgccaccacgcatggcatcacggtgcgggtggcggtc
agctttctgccggaccggtcgcgcgcggacagtgcccgttggttctggtcgtatcacatc
cgtatcgagaatcattccgacagcgccgtgcagctgctcacccgccactgggtgatcacc
gatggccgcggcggcgtgcaccaggtcgatggcgaaggcgtggtcggcgaacagccggtg
atccttccgggcaagtcgcacgattatgtctcgggttgcccgctcaccaccccaaccggg
cggatggaaggcgtctatcggatgatgcgtgacgatgatgagctgatcgcggtcgaaatt
ccgcgttttccgctggtcgccccggcagttgccgattaa

DBGET integrated database retrieval system