KEGG   Blastomonas fulva: B5J99_02780Help
Entry
B5J99_02780       CDS       T05612                                 

Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
bfw  Blastomonas fulva
Pathway
bfw00860  Porphyrin and chlorophyll metabolism
bfw01100  Metabolic pathways
bfw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B5J99_02780
Enzymes [BR:bfw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     B5J99_02780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM
Motif
Other DBs
NCBI-ProteinID: ASR50524
UniProt: A0A222WXH7
Position
578175..579518
Genome map
AA seq 447 aa AA seqDB search
MWTFHPDLLARPVPRYTSYPTAADFVDEVGAEQYAGALAGMASATPLSLYVHIPYCDQIC
WYCGCNTGAANRKHRLTDYLTALRAEIAMVAKRLGGRGRVQHIAFGGGSPNAITPVDFVR
LLDRIMTVFDCSDPEISIEVDPRTFTLEWARVLASSQVSRVSMGVQTFSPRIQAAIGRVQ
PLEHIEQAVMSLRMRGIDSINFDLMYGLPGQTLDDLDGTLEQTIRLAPSRIALFGYAHLP
TMIPRQKRIDASNLPDDRQRFEQAAFGYLRLRDAGYVPVGFDHFALPSDPLAVAALENRV
NRNFQGFTHDGASTLLGFGASAISILPGLIVQNEKNAGPYRALVGAGQLPASRGVAPDAQ
DSARSAIINAILCRGRVRLADDLLPPARAALAEFERRGLLFWDADMLVLNPGSEPYARVI
AAQFDGYRGAIHPRGGPVSLHSAAPAC
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgtggacctttcaccccgatctgctcgcccggcccgtgccgcggtataccagctacccg
acggcggcggattttgtcgatgaggtgggggcggagcaatatgcaggtgcgcttgccgga
atggcgtcggcgaccccgctgtcgctgtatgtccacatcccctattgcgaccagatctgc
tggtattgcgggtgcaacacgggagctgccaaccgcaagcaccggctgacagactatctc
accgcactgcgcgccgagatcgcgatggtcgccaagcggctgggcggacgtgggcgcgtt
cagcatatcgcctttggcgggggcagccccaacgcgatcactcctgtcgatttcgtgcgc
ctgctcgaccggatcatgaccgtgttcgattgcagcgacccggagatatcgatcgaggtc
gatccgcgcaccttcacgctggaatgggcgcgtgtgctggcctcgtcgcaggtcagccgg
gtgagcatgggagtgcagaccttctcgccgaggatccaggcggcaatcggcagagtgcag
ccgctcgagcatatcgaacaggcggtgatgagcttgcggatgcgcggcatcgattcgatc
aatttcgatctgatgtacggcctacccggccagacgctcgacgatctcgacggcacgctg
gaacagaccatccgcctcgcccccagccgtatcgcgctgttcggctatgcacatcttccc
accatgatcccgcggcagaagcggatcgatgcgagcaacctgcccgatgaccggcagcgt
ttcgaacaggccgcgttcggctacctgcggctgcgcgatgctggctatgtcccggtcggg
ttcgatcatttcgcgctgccatcggatccgctggcggtcgccgcactggagaaccgcgtg
aaccgcaatttccaggggttcacccatgacggcgcatcgacgctgctgggcttcggggcg
agcgcgatcagcatcctgcccgggctgatcgtgcagaacgagaagaacgccggaccctat
cgcgcgctggtcggcgcaggccagctgcccgcctcgcgcggggtcgcgcccgatgcgcag
gacagcgcccggtccgcgatcatcaacgccatcttgtgccggggccgcgtgcgtctggcc
gatgacctgctccctcctgcccgcgccgctcttgccgagttcgaacggcgcgggctcctt
ttctgggatgccgacatgctcgtgctcaaccccggatcagaaccctatgcccgcgtgatc
gcggcgcagttcgacggctatcgcggtgcgattcatccgcgtggcggacctgtcagcttg
cattccgccgcgcctgcctgttga

DBGET integrated database retrieval system